KEGG   Rattus norvegicus (rat): 117185
Entry
117185            CDS       T01003                                 

Gene name
Neu3
Definition
(RefSeq) sialidase-3
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00511  Other glycan degradation
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    117185 (Neu3)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    117185 (Neu3)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     117185 (Neu3)
SSDB
Motif
Pfam: BNR_2 BNR_3 BNR
Other DBs
NCBI-GeneID: 117185
NCBI-ProteinID: NP_446462
RGD: 619881
Ensembl: ENSRNOG00000018106
UniProt: Q99PW5
Position
1
AA seq 418 aa
MEEVSSCSLRSTLFQQEEQNRITYRIPALLYIPPTHTFLAFAEMRTSSRDEDAVYLVFRR
GVMKGCSVEWGPQQPLMEATLPGHRTMSPCPVWEKNTGRVYLFFICVQGHVSERWQLLWG
RNAARLCFLYSEDSGCSWGEVKDLTEEVVGSEMKHWATFAVGPGHGIQLQSGRLLIPAYA
YLISCWFLCFPCSVKPHSLMFYSDDLGVTWHCGKFIKPQVTGECQVAEVPGKAGNLVLYC
SARTPNKFRAEAFSTDSGDCFQKPTLNQQLCEPRGGCQGSVVSTRPLKMPYTCQDSSGKD
VPSTQKCPLMDRSLEVEEGAGAPSGTWLLYSHPTNKKKRMNLGIYYNQNPLEVNYWSRPW
ILNRGPSGYSDLAVVEGQGLFACLFECGERHEDEKIDFCLFSDQEVLSCDDCTSPSSN
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggaagaagtttcatcctgctccctccgcagcactctgttccagcaggaagaacagaac
aggattacctaccggatcccagcactgctgtacattcctcccacccacaccttcctggcc
ttcgcagagatgcgtacctcaagcagagatgaggatgctgtctacctggtgttcagacga
ggggtgatgaaggggtgctctgttgagtggggcccccaacagccactgatggaggccaca
ttacctgggcatcgcaccatgagcccctgccctgtgtgggagaagaatactggccgtgta
tacctgtttttcatctgcgtgcagggccatgttagtgagcgctggcagcttctgtggggc
aggaatgctgcccgtctctgcttcctttacagtgaggactctgggtgctcgtggggtgaa
gtgaaagatttgactgaggaagtcgttggctcagagatgaagcactgggccacgtttgct
gtgggcccaggtcatggcatccagctgcagtcggggaggctgctcattcccgcctatgcc
tacttgatatcatgctggtttctctgctttccatgttcagtcaagccccattccctaatg
ttctacagtgatgacttaggagtcacatggcactgtggcaagttcattaagccccaggtg
acaggggagtgccaagtggcagaagtgcctgggaaggctggtaaccttgtgctctactgc
agtgcccgaacaccaaacaaattccgagcagaggcttttagcactgatagtggtgactgc
tttcagaaaccaaccctgaaccaacaactctgcgagcctcgtggtggctgccaaggtagt
gtagtgagcacccggcctttgaagatgccatacacatgtcaagactcaagtggtaaagat
gttccctctactcagaaatgccctctgatggacagatctctggaggtggaggaaggagct
ggagcaccatcagggacatggctcttgtactcacatccaactaacaagaagaagagaatg
aacctaggcatctactacaaccaaaaccccttggaggtgaactactggtcccgcccgtgg
atcttgaaccgtgggcccagtggctactctgacctggctgtggtagaaggacagggcttg
ttcgcgtgcttatttgagtgtggggagaggcatgaggatgagaagattgacttttgtctg
ttttcagaccaagaggtcctgagctgtgacgactgtaccagccctagtagcaactaa

KEGG   Rattus norvegicus (rat): 24591
Entry
24591             CDS       T01003                                 

Gene name
Neu1
Definition
(RefSeq) sialidase-1 precursor
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00511  Other glycan degradation
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    24591 (Neu1)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    24591 (Neu1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    24591 (Neu1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     24591 (Neu1)
SSDB
Motif
Pfam: BNR_2 BNR_3 BNR
Other DBs
NCBI-GeneID: 24591
NCBI-ProteinID: NP_113710
RGD: 3163
Ensembl: ENSRNOG00000032942
Vega: OTTRNOG00000001721
UniProt: Q6MG70
Position
20
AA seq 409 aa
MVGAEPSRPPGPPSYWTGRRGQGLAAIFLLLVSAAGSEARTEDDFSLVQPLVTMEQLLWV
SGKQIGSVDTFRIPLITATPRGTLLAFAEARKKSASDEGAKFIAMRRSTDQGSTWSSTAF
IVDDGEASDGLNLGAVVNDVDTGVVFLIYTLCAHKVNCQVASTMLVWSKDDGVSWSPPRN
LSVDIGTEMFAPGPGSGIQKQREPWKGRLIVCGHGTLERDGVFCLLSDDHGASWHYGTGV
SGIPFGQPKHDHDFNPDECQPYELPDGSVIINARNQNNYHCRCRIVLRSYDACDTLRPRD
VTFDPELVDPVVAAGALATSSGIVFFSNPAHPEYRVNLTLRWSFSNGTSWQKERVQLWPG
PSGYSSLTALENSTDGKKQPPQLFVLYEKGLNRYTESISMVKISVYGTL
NT seq 1230 nt   +upstreamnt  +downstreamnt
atggtgggggcagagccaagcagacccccgggaccaccgagctactggacaggccggcgg
ggtcaggggctcgcagcgatcttcctgctcctggtgtccgcggcgggatcagaggccagg
acagaggatgacttcagcctggtgcagccgctggtgaccatggagcaattgctgtgggtg
agcgggaagcagatcggctccgtagacacttttcgaatcccgctcatcacagccacccct
cggggcacgctcctggccttcgctgaggctaggaaaaagtctgcatccgatgagggggcc
aagttcatcgctatgaggaggtccacagaccagggtagcacgtggtcctctacggctttc
attgtagacgacggggaggcctccgatgggctgaacctgggggctgtggtgaacgacgta
gacacaggagtggtgttcctcatctataccctctgtgctcacaaggtcaactgccaggtg
gcctctaccatgctggtttggagtaaggatgacggcgtttcctggagcccaccgcggaat
ctctccgtggatattggcacagagatgtttgcccctggacccggctctggcattcagaaa
cagcgggagccttggaagggccggctcattgtgtgtggacacgggacgctggagcgagat
ggggtcttctgtctcctcagtgatgaccacggtgcctcctggcactatgggactggagtg
agcggcattcccttcggccagcccaaacacgatcacgatttcaaccccgacgagtgccag
ccctacgagcttccagacggctcagtcatcatcaacgcccggaaccagaataactaccac
tgccgctgcaggatcgtcctccgcagctatgacgcctgtgacaccctcaggccccgggat
gtgaccttcgaccctgagctcgtggaccctgtggtagctgcaggagcgctagccaccagc
tccggcattgtcttcttctccaatccagcccatcccgagtaccgagtgaacctgaccctg
cgctggagcttcagcaatggcacatcctggcagaaggagagggtccagttgtggccggga
cccagcggctactcatccctgacagccctggaaaacagcacggacgggaagaagcagccc
ccgcagctgttcgttctgtacgagaaaggactgaaccggtacacggagagcatctccatg
gtcaaaatcagcgtctacggcacgctctga

KEGG   Rattus norvegicus (rat): 29204
Entry
29204             CDS       T01003                                 

Gene name
Neu2
Definition
(RefSeq) sialidase-2
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00511  Other glycan degradation
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    29204 (Neu2)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    29204 (Neu2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     29204 (Neu2)
SSDB
Motif
Pfam: BNR_2 BNR BNR_3
Other DBs
NCBI-GeneID: 29204
NCBI-ProteinID: NP_058826
RGD: 3164
Ensembl: ENSRNOG00000016962
UniProt: Q5BK97
Position
9
AA seq 379 aa
METCPVLQKETLFHTEVYAYRIPALLYLKKQKTLLAFAEKRASRTDEHAELIVLRRGSYN
GATNHVKWQPEEVVTQAQLEGHRSMNPCPLYDKQTKTLFLFFIAVPGRVSEQHQLQTRVN
VTRLCRVTSTDYGMNWSPVQDLTETTIGSTHQDWATFAVGPGHCLQLRNRAGSLLVPAYA
YQKLHPVHKPTPFAFCFISLDHGHTWELGNFVSENSLECQVAEVGTGAHRVVYLNARSFI
GARVQAQSPNDGLDFQDNQVVSKLVEPPHGCHGSVVAFHSPTSKPDALDMWLLYTHPTDS
RNRTNLGVYLNQTPLDPTAWSEPTLLATGTCAYSDLQNMGRGPDGSPQFGCLYESGNYDE
IIFLMFTLKQAFPTVHGAQ
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggagacctgccccgtcctccagaaagagacgctgttccacacagaagtctatgcttac
agaatccctgctctgctctacctgaagaagcagaagaccctgctggcctttgcagaaaag
cgagccagcaggacggatgagcatgctgagttgattgtcctgcgaagagggagctacaat
ggagccaccaaccatgtcaagtggcaacctgaggaagtggtgacccaagcccagctggag
ggccaccgctccatgaatccatgtcccttgtatgacaagcaaacaaagaccctcttcctt
ttcttcattgctgtccctgggcgtgtatcagaacagcatcagctccaaactagggttaat
gtcacacggctatgccgtgtcaccagcaccgattatgggatgaactggagccccgtccag
gacctcacagagaccaccattggcagcacccaccaggactgggccacatttgctgtgggt
ccagggcactgtctgcagctgcggaacagagctgggagcctgctggtacctgcttatgcc
taccagaagctgcaccctgtccataaacctaccccctttgccttctgcttcatcagcctt
gaccacgggcacacgtgggaactagggaactttgtgtctgagaactcactggagtgtcag
gtggctgaggttggcactggtgctcatagggtggtatatctcaatgctaggagcttcata
ggagctagagtccaggcacaaagtcctaacgatggcctggatttccaggacaaccaggta
gtaagtaagcttgtagagcccccccacgggtgtcatggaagtgtggtcgccttccacagc
cccacctctaagccagatgccttagacatgtggctgctttatacccaccctacggactcc
aggaatagaaccaacctgggcgtgtacctcaaccagacgccactagatcccacagcctgg
tcagagcccaccctgctagccacgggcacctgtgcctactcagacttgcagaatatgggg
cgtggccctgatgggtccccacagtttgggtgcctgtatgaatcaggtaactatgacgag
atcattttcctcatgttcaccctgaagcaagcttttcccacagtacatggtgctcagtga

KEGG   Rattus norvegicus (rat): 316642
Entry
316642            CDS       T01003                                 

Gene name
Neu4
Definition
(RefSeq) sialidase-4
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00511  Other glycan degradation
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    316642 (Neu4)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    316642 (Neu4)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     316642 (Neu4)
SSDB
Motif
Pfam: BNR_2 BNR_3 BNR DUF5466
Other DBs
NCBI-GeneID: 316642
NCBI-ProteinID: NP_001101704
RGD: 1308624
Ensembl: ENSRNOG00000019031
UniProt: D3ZWB7
Position
9
AA seq 478 aa
MGPAHVPKRTVLFQRERTGLTYRVPALLCVPPRPTLLAFAEQRLSPDDSHAHRLVLRRGT
LTRGSVRWGVLSVLETAVLEEHRSMNPCPVLDEHSGTIFLFFIAVRGHTPEAVQIATGKN
AARLCCVTSCDAGLTWGSVRDLTEEAIGAALQDWATFAVGPGHGVQLRSGRLLVPAYTYH
VDRRECFGRICWTSPHSLAFYSDDHGISWHCGGLVPNLRSGECQLAAVDGDFLYCNARSP
LGNRVQALSADEGTSFLPGELVPTLAETARGCQGSIVGFPAPPSIGPQDDRWLASPGNTP
HSPCFDLRVRESLAEGARGFVEGWASRLLLCYPQSRGPENHGLEPGPDGEKTSWSPELPM
SSASVRQSSTWLLYSHPAGRRARLHMGIYLSRSPLDPHSWTEPWIIYEGPSGYSDLAFLG
PVPGASLAFACLFESGTRASYEDISFCLFSLADVLENVPTGLEISSLRNKPQGHCWPS
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggggcccgcgcatgttcccaagagaaccgtgctcttccagcgggaaaggactggtctg
acctaccgggtgcctgcgctgctctgcgtgcctcccaggcctaccctgctggccttcgca
gaacagcgacttagccctgatgactcccatgcccaccgcctggtgctacggaggggcacg
ctgaccaggggctcagtgcggtggggcgttctgagtgtactggaaactgcagtactggag
gagcacaggtctatgaatccttgccccgtgctggatgagcactcgggtaccatcttcctc
ttcttcattgctgtgcggggtcacacaccggaggccgtgcaaatcgccactggcaagaac
gctgctcgcctctgctgtgtgaccagctgtgacgctggccttacctggggcagcgtgcgg
gatctcactgaggaagccattggtgctgcattgcaggactgggccacctttgccgtgggt
ccaggccatggagtccagctgcgctcgggtcgcctgcttgttcctgcttacacctatcat
gtggaccgtcgggagtgttttggcaggatctgctggaccagtccccactccttggctttc
tacagtgatgaccatgggatctcctggcattgcggaggccttgtgcccaacctacgctct
ggagagtgccaactggctgcggtggatggagactttctctactgtaatgcccggagccct
ctgggtaaccgtgtgcaggcactgagtgctgatgaaggcacttccttcctaccaggggag
ctggtgcctacgttggctgagactgctcgcggctgccagggtagcattgtgggcttcccg
gctccaccttccatcggtcctcaggatgaccggtggttagcgagtcctggaaacacccca
cattccccatgcttcgatctcagagtacgggagtctttggcggaaggtgctagaggtttt
gttgaaggttgggcgtctaggttgcttctctgctacccacagtcccggggcccagagaat
catggcctagagcctgggccagatggagaaaaaacatcctggagcccggaactccctatg
tcctctgcttccgtgcgtcagagctccacatggttgctatattcccacccagcagggcgt
agagctcggctccatatgggaatctacctgagccgatcccccttggaccctcacagctgg
acagagccctggataatctatgaaggccccagtggctactctgaccttgccttccttggg
cctgtgcctggggcatccctggcttttgcctgcctgtttgagagcgggaccagggcttcc
tatgaagacatttctttttgcttgttctcactggctgatgtcctggagaatgtacccact
ggcttagagatatccagtctcaggaataagcctcaggggcattgctggccctcttga

DBGET integrated database retrieval system