KEGG   Rattus norvegicus (rat): 117249
Entry
117249            CDS       T01003                                 

Gene name
Dnah3
Definition
(RefSeq) dynein heavy chain 3, axonemal
  KO
K10408  dynein heavy chain, axonemal
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    117249 (Dnah3)
   05016 Huntington disease
    117249 (Dnah3)
   05022 Pathways of neurodegeneration - multiple diseases
    117249 (Dnah3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    117249 (Dnah3)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     117249 (Dnah3)
SSDB
Motif
Pfam: AAA_6 DHC_N2 Dynein_C AAA_8 AAA_9 AAA_7 AAA_lid_11 MT Dynein_heavy Dynein_AAA_lid AAA_lid_1 AAA_5 AAA AAA_16 AAA_22 ARL2_Bind_BART Sigma54_activat T2SSE Exonuc_VII_L
Other DBs
NCBI-GeneID: 117249
NCBI-ProteinID: XP_038957096
RGD: 1305855
Position
1
AA seq 4069 aa
MSQIDCSSQKLDKSDSIHHMSHSQARPELPPLPVSANEEPSEIYKTVMSHSFYPPLMQRT
SWTLAVPFKEQDQHRGPSDSIGNNYSLTARDMKLKDLVKVYQPVTISVPRDKASQGLPLA
SKTSTEPSKKKMKLCIKGKDDATGTPLACKHSSSSNMKNATDSSLTYPESRPMSPEQQMD
VMLQQEMEVESKENKPSELDLERYYYYLTNGIRKDMIAPEDEDVMVRIYKLIPKTLLTTP
ALEPLQVSLRSEKESDYYYSLMKSIVDYILMDPLEKKRLFIKSIPRLFPHRVIRAPVPWH
NIYQSVKKWNEEHLHTVNPMMYTLKELWFSEFKDLRFIRTADLLAGKLPLLPHEYQEEIQ
KHCLDARQVLLSKWIPTCAQLFVTQKERWVHFAPKNDYDSSRNIEEYFASVASFMSLQLR
ELVIKSLGDLVSFFMIHKDGNDFNEPYQEMDFFIPQLITIKLEVDDPVIVFNPTFDDCWQ
LIKESFLEIIKNSNGIPKVESILFPDLKGYNMILGTVDPEENLVADFLNQTLEVFNKNQV
GPHKYLNVYKKYDDLLDNTAEQDISTFLNDKHDIDDFVTSINSIKKRRNEIASMHITVPL
AMFCLDAVLLNHDLCERAQNLKDRLIQYQVDVNRETNTSICNQYSTIADKVSETPANTAE
LVALIEYLKKSSDVTVFKLRRQLRDASERLEFLMDYADLPNEDIKLNSNLFLWPDQIEDV
FENSRNLLLSKRDQAEMDLIKRCSEFETRLEGYSKELEMFRKREVMTTEEMKNNVEKLND
LSKNLDLALTEFELINKEEELLEKEKSSFPLLQVLMVNKIPYEQLWVTAYEFSTKSEEWM
NGPLFLLNAEEIAEDIGNMWRTTYKLTKTLIDVPAPRRLAENVKLKIEKFRQHIPVLTIA
CNPGMKDRHWQQISDIVGYEIKPTETTCLANMLEFGFSKFVDKLEPIGAAASKEYSLEKN
LEKMKSDWVNMCFSFVKYRDTDTSILCAVDDIQLLLDDHVIKTQTMCGSVFIKPIEAECR
KWEEKLVRVQENLDAWLKCQATWLYLEPIFSSEDIIAQMPEEGKKFGIVDSYWKSLMAQA
VNDTRVLVAADQPRMTEKLQEANVLLEDIQRGLNDYLEKKRLFFPRFFFLSNDELLEILS
ETKDPLRVQPHLKKCFEGIAKLEFTDNLEIKGMISSEKEIVPFIQTIYPVKAKGMVEKWL
QQVEQVMVASMRQVIEDGIEAYLKVPRNAWVLQWPGQVVICVSSIFWTREVSEALVEYTL
TDFLKKSNDQIAQIVELVRGKLSSGARLTLGALTVIDVHARDVVAKLEQDNINSLNDFQW
ISQLRYYWVESNVQVQMITTQALYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAP
EGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIE
VEVLSVVAQQILSIQQAIIRKLKMFIFEGTELSLNPTCAVFITMNPGYAGRAELPDNLKA
LFRTVAMMVPDYALIGEISLYSMGFLDSRSLAQKIVATYRLCSEQLSSQHHYDYGMRAVK
SVLTAAGNLKLKYPEENESVLLLRALLDVNLAKFLAQDVPLFQGIISDLFPGVVLPKPDY
EVFLEALNNNIRNMKLQPVPWFIGKIIQIYEMMLVRHGYMIVGDPMGGKTSAYKVLAAAL
GDLHAANQMEEFAVEFKIINPKAITMGQLYGYFDAVSHEWTDGVLANAFREQASSVTDER
KWIIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSSKMSLIFEPADLEQASPATVSR
CGMIYMEPHQLGWKPLKDSYMDTLPPCLNKEHTELVEDMFTWLVQPCLDFNRLHSKFVVQ
TSPIHLAFSMMRLYSSLLDELWAIQEEEMEIYEGLSSQQIFLWLQGLFLFSLVWTVAGTI
NAESRKKFDVFFRNLIMGMDDHNPRPKSVKLTKNNIFPERGSIYDFYFLKQGGGHWNAWT
EYITKEEETIPANAKVSDLIIPTMETARQTFFLKTYLDHEIPILFVGPTGTGKSAITNNF
LLHLPKNVYQPNFINFSARTSANQTQDIIMSKLDRRRKGLFGPPIGKKAVVFVDDLNMPA
KEVYGAQPPIELLRQWIDHGYWFDKKDTNRLDIVDVLLVTAMGPPGGGRNDITGRFTRHL
NLLSINAFEDEILTKIFSSIADWHFGKGFDVMFLRYGRMLVQATQIIYRAAVENFLPTPS
KSHYVFNLRDFSRVIQGVLLCPHTHLQDLEKFIRLWIHEVYRVFYDRLIDNDDRQTFFNL
VKETTSNCFKQTVEKVLIHLSPTGKITDENIRSLFFGDFLKPESDQKIYDEIIDLRNLTV
VMEYYLDEFNSVSKAPMSLVMFKFAIEHISRICRVLKQNKGHLLLVGIGGSGRQSATKLS
TFMNSYELYQIEITKNYTGNDWREDLKKIMLQSGVATKSTVFLFADNQIKDESFVEDINM
LLNTGDVPNIFPADEKADLVEKMQTAARTGGEKIEVTPLSMYNFFIERVRKNLHIVLAMS
PIGDAFRTRLRMFPSLINCCTIDWFQSWPTDALELVANKFLEDVELDDNIRAEVVSMCKY
FQESAKKLSVDYYNTLLRHNYVTPTSYLELILTFKTLLNSKRHEVDLMRNRYLAGLQKLE
FASSQVAVMQVELTALQPQLIQTSENTAMMMVKIEMETKEADAKKLLVQADEKEANAAAA
VAQAIKNECEGDLAEAMPALEAALAALDTLNPADITLVKSMQNPPGPVKLVMESICVMKG
LKPERKPDPSGSGKMIEDYWGVSRKILGDLKFLESLKTYDKDNISPVIMKRIRERFIDHP
DFQPAVIKNVSSACEGLCKWVRAMEVYDRVAKVVAPKRERLREAEGKLEIQMHKLNQKRA
ELKLVEDRLQALNDEFELMNSKKNMLEENIEICSQKLIRAEKLISGLGGEKDRWTEAARL
LGIRYDNLTGDVLLSSGTVAYLGAFTVDYRAQCQTEWLISCKDKVIPGSVDFSLSNTLGD
PIKIRAWQIAGLPVDSFSVDNGIIVSNSRRWPLMIDPQGQANKWVKNMEKTNKLSVIKFS
DTNYVRTLENALQFGTPVLLENVGEELDAFIEPILLKATFKQQGVEYMRLGENIIEYSRE
FKFYITTRLRNPHYLPEVAVKVCLLNFMITPLGLQDQLLGIVAAKEKPELEEKKNKLILE
SAENKKQLKEIEDKILEVLSLSEGNILEDETAIKVLSSSKILSEEISEKQEIASVTETQI
DETRMGYKPVAIHSAAIFFCISDLAHIEPMYQYSLTWFINLYVLSLANSNKSDELDLRIE
YIIEHFTLSIYNNVCRSLFEKDKLLFSLLLTIGLLKEKKAIDEEVWYFLLTGGVALDNPF
PNPAPEWLSEKSWGEIVRASSLPKLKGLMDDLSRNLTEWKAIYDSAWPQDESLPSPWVFL
QALEKMAILRCLRPDKIVPAIQDFISETMGKVFIEAPTFDLQGSYNDSSCCAPLIFILSP
GADPMAGLLKFADDLGMGGTKTQTISLGQGQGPIAAKMIHKAIHEGTWVVLQNCHLATSW
MPALEKICEEVIIPENTNRDFRLWLTSYPSEKFPVSILQNGIKMTNEPPKGLRANLLRSY
LNDPISDPVFFQSCTKPVIWQKLLFGLCFFHAIVQERRNYGALGWNIPYEFNESDLRISM
RQIQMFLNDYKEVPFEALTYLTGECNYGGRVTDDKDRRLLLSLLSTFYCKEIETDHYYIA
PGQPYFIPPHGSYQSYIEYLRTLPITAHPGVFGLHENADITKDNQETNQLFQGVLLTLPR
QSGGSGKSPQEVVEELAQDILSKLPKDFNLEEVMKLYPVVYEESMNTVLRQELIRFNRLT
KVVRRSLIDLGRAIKGQVLMSSELEEVFNSMIVGKVPAMWAAKSYPSLKPLGGYVADLLA
RLAFFQEWINKGPPVVFWISGFYFTQSFLTGVSQNYARKYTIPIDHIGFEFEVTSKETTM
ENIPEDGAYIKGLFLEGARWDRTIRQIGESLPKILYDPLPIIWLKPGESASFLHQDIYVC
PVYKTSARRGTLSTTGHSTNYVLSIELPTDMPQKHWINRGVASLCQLDN
NT seq 12210 nt   +upstreamnt  +downstreamnt
atgagccagatcgactgctcatcgcagaagcttgacaaaagtgactccatacatcacatg
agccactcccaggcacggccagaactgcctcctctgcctgtgtctgcaaatgaggagcct
tctgaaatctataagacagtcatgtcacacagcttctatcccccactgatgcaacgcaca
tcctggaccctggctgtgcccttcaaagagcaggaccagcaccgtggacccagtgactct
attggcaataactattccttgacagctcgggacatgaagctgaaagacctggtgaaggtc
taccaacccgtcactatcagtgtccctagggacaaggccagtcaaggactgccattagca
tctaaaacctcaacagagccctccaagaagaaaatgaagttgtgcatcaaaggcaaggat
gatgctacagggacaccgcttgcctgcaaacactcatcctcttcgaacatgaagaacgcc
acggactccagcttgacctacccagaaagcagacccatgagtccagaacaacagatggat
gtgatgttgcaacaggagatggaagtggaaagtaaagagaacaaaccgtctgaattagac
ctggagagatattactactatttgaccaatggtatccgaaaagacatgattgccccagag
gatgaggacgtgatggtgcgaatttacaagctgatccctaagacgctgctgacaactcca
gccctcgaaccccttcaagtctcccttaggtctgagaaggaaagtgactattactatagc
ctcatgaaaagcatcgttgactacatcctcatggacccattggagaagaaaaggctgttc
atcaagagcatccctcgcttgtttcctcacagagtgatccgggcccctgtgccctggcac
aacatctaccagagtgtcaagaagtggaatgaggagcatttgcacacagtgaatcccatg
atgtacaccctcaaagaactgtggttttcagaatttaaagacctcaggttcattcggaca
gcagacttactggctggaaaactgcctctgctgcctcatgagtaccaggaggagatacag
aagcactgcctggatgcgcgtcaggttctactctccaaatggatccccacctgtgcccag
ctttttgtgacacagaaggaacgctgggtccactttgctcccaagaacgactatgactcc
tcccgaaacatcgaggaatactttgcttctgttgcttccttcatgtccctacagctcaga
gagttggtcattaagtccctcggggacctcgtttctttcttcatgattcacaaggatgga
aacgattttaatgagccgtaccaagagatggacttctttatacctcagctaatcacgatt
aaacttgaagtggatgatcctgttattgttttcaacccaacttttgatgactgctggcaa
ttaataaaggaatccttcttggaaattattaagaattctaatgggatccccaaggtggaa
tctatcctcttcccagatttgaaaggctacaacatgatccttggaactgttgatcctgaa
gaaaaccttgttgcagattttttgaatcagactttagaggtatttaacaaaaatcaagtt
ggacctcacaaatatttaaatgtatacaaaaagtatgacgacttactggacaacacggct
gagcaagacatcagcacattcttgaatgataaacatgacattgacgactttgtgacgagt
atcaacagcatcaaaaagagaagaaatgaaattgcatccatgcacatcaccgtgcccttg
gccatgttctgtcttgatgccgtgttactaaatcatgacctctgtgagcgagcccaaaat
cttaaagaccgtttgattcagtaccaagtagatgtaaaccgggaaaccaataccagcatt
tgtaatcagtacagcaccattgctgataaagtcagtgagacccctgccaacaccgcggag
ctagtggccctcatcgaatacttaaagaaatccagtgatgtcactgtgttcaagctcagg
aggcaactcagagatgcaagtgagaggcttgagttcctgatggattatgcagacttgccc
aatgaagatatcaaactgaacagcaacctgttcctctggcctgaccagatagaagatgtc
tttgaaaatagccgaaatctactccttagcaagagggatcaggcggagatggacctcatc
aaaaggtgctcagaatttgagaccagactcgaaggctacagcaaagagctggaaatgttc
aggaagcgtgaagtgatgactaccgaagaaatgaagaataatgtggaaaagcttaacgac
ctctcaaagaacctagatctggcactgacagaatttgagttgatcaacaaggaagaggag
ctgctggagaaggagaagagctccttccctcttctgcaagtcctgatggtcaacaaaatt
ccctatgagcagctatgggtcacagcctatgagttcagcaccaaatcagaggaatggatg
aatggccccctctttttattgaatgctgaggaaattgcagaggacatagggaatatgtgg
agaacaacctacaagttgaccaagaccttgattgatgtgcctgcacccaggcgcttagca
gagaacgtcaagttgaagatcgagaagttcaggcagcacatacccgtcctcaccattgcc
tgcaatcctgggatgaaggatcggcactggcaacagatcagtgacattgttggctatgag
ataaagcccacagagaccacgtgcctcgcaaacatgttggaatttggattcagcaaattt
gttgataagctggaacccattggggcagccgccagcaaggaatattcgctggagaaaaac
ttggagaagatgaagtcagactgggtcaatatgtgcttcagctttgtgaagtacagggac
acggataccagcatcttgtgtgcagttgacgacattcaattactactcgatgaccatgtg
ataaagacccagactatgtgtggttcagtattcatcaagccaatagaagcagagtgccgg
aaatgggaagaaaagttagttcgggtacaagaaaatttggatgcctggttaaaatgccaa
gccacttggctgtacctggaaccaatcttcagctcagaagatatcatagcccagatgcca
gaggagggcaagaagtttggcattgtggacagttactggaaatcactcatggcccaggcg
gtaaatgatacaagggttttggtggcagctgaccagccaaggatgactgagaagcttcag
gaagccaatgttctgttggaagacatccagcgggggctgaatgactacctggagaagaag
aggctctttttccccaggttcttcttcctgtcaaatgatgagcttctggagatcttgtca
gagacaaaggacccactccgagtacagccacacttgaagaagtgcttcgaaggaattgcc
aagctggagtttacagacaatctagaaatcaagggcatgatcagctcagaaaaagaaatt
gttccattcatacagacaatctacccagtgaaagccaagggcatggtggaaaagtggctg
cagcaggtggagcaggtgatggtggccagcatgcggcaagttattgaagatggtattgaa
gcttatctcaaggtccctcggaatgcctgggtcttgcagtggcctggccaggtcgttatc
tgtgtctcttccatcttttggaccagggaagtgtctgaagccctagttgaatacaccctt
acagactttctgaaaaagagcaatgaccagatcgcacagattgttgagctggtgcgaggg
aagctgagcagtggtgcgaggctcactctcggggccctcactgtcatcgacgtgcatgct
cgtgatgtggtggccaagctggagcaagataatatcaacagtctaaatgacttccagtgg
atctcacagctacggtactattgggtggaaagcaatgttcaagtgcaaatgataaccacg
caagccttgtatggctacgagtacttgggaaactcccctcggctggtgatcactcctctc
acagaccgctgctacaggaccctaatgggagctttgaagctgaaccttggaggcgctcca
gagggtccagctgggacaggcaagacagagaccaccaaagatctggccaaagctttggcc
aagcagtgtgtggtcttcaattgttctgatggtttggattacaaagccatggggaagttc
ttcaaggggctggcccaagctggagcatgggcctgttttgatgaattcaacaggattgag
gtagaagtactgtcggtggtggcccaacagattctcagcatccaacaagccattatccgg
aagctgaagatgttcatctttgaaggcactgagctctcactgaacccaacctgtgccgtc
ttcatcaccatgaaccctgggtatgctggcagggctgagcttccagataacctcaaggcc
ttatttcgaacagtagccatgatggtgccagattatgctcttattggagaaatctccctc
tattctatgggctttctggactccagaagtcttgcccagaagattgttgccacctaccgc
ctgtgctctgagcaactctcatcccagcaccactatgactatggcatgcgggctgtcaag
tctgtgctcacagctgcaggcaatctgaagcttaagtaccctgaggagaatgagagtgtt
ctgctgctccgggccttgctggatgtcaacctggccaagttcttggctcaagatgtcccc
ctgtttcagggaattatctcagatctgtttcctggagttgttcttccaaagccagactac
gaggttttcctggaagcattgaacaacaacatcagaaatatgaagctgcagccagtgccc
tggttcattggaaagattatccagatctatgagatgatgctggtaagacatggctacatg
attgttggagatccaatgggtggcaagacatcagcttataaggttctggctgcagctctg
ggtgatttacatgcagccaaccagatggaggagtttgctgtggagttcaagatcatcaac
cccaaggccatcacaatggggcaactgtatggctactttgatgctgtgagccatgagtgg
acagatggtgtcctggccaatgctttccgggagcaagcatcttccgtaactgatgaacgc
aaatggattatatttgatgggccagtagatgctgtttggatcgaaaatatgaacactgtc
ttggatgacaataaaaagctgtgtttaatgagtggagagatcatacagatgagctccaag
atgagtctgatctttgagccagcagatctggagcaggcttcccctgccaccgtgagcagg
tgtgggatgatctacatggagccccaccagctaggctggaagcccttgaaggattcgtac
atggatactctgcccccctgtctcaacaaggaacacacggaactggttgaggacatgttc
acatggcttgtgcagccctgtctggactttaatcggctccatagcaaatttgtggtgcaa
acttctcccatccatcttgccttctcaatgatgcggctgtactcctccctgcttgatgaa
ctctgggccatccaggaggaggaaatggagatatatgaaggtctgtcaagccagcagatc
ttcctctggctgcaaggcctgtttcttttctccttggtgtggactgtggcaggtaccatc
aatgccgagagcagaaagaaatttgatgtgtttttccgcaacctgatcatgggcatggat
gatcataacccaaggcccaagagtgtgaaactcaccaaaaacaacatctttccagaaaga
ggaagcatctatgatttttacttcctcaaacaagggggtggacactggaatgcgtggaca
gaatatatcaccaaggaggaggagactatccctgccaacgcaaaggtatcagacctcatc
attcccacgatggagactgcccggcagaccttcttcttaaaaacctacctggaccacgag
attcccatactgttcgtgggtcccacaggaactggcaaatcagccatcaccaacaacttc
cttctccaccttcccaaaaatgtctaccagcccaacttcatcaatttctctgccagaact
tcagccaaccagacccaggatatcatcatgtctaagctggatcgtcgaaggaaaggcctt
tttgggcctcccattgggaagaaagcagtggtgtttgtagatgaccttaacatgccagcc
aaagaggtgtatggagcccagccccccattgagctgctgcgacaatggattgaccacggc
tactggtttgacaagaaagacacaaacaggctggacattgtggatgttctgcttgtgact
gccatgggtccccctggtggaggaaggaatgacatcactggacggttcactcgccatcta
aatctcctttccatcaatgcctttgaggatgaaatcttaaccaaaattttcagttctatc
gctgactggcattttgggaaagggtttgatgtcatgttcttacggtatgggaggatgctg
gtccaagcaacccagatcatttacagagctgcagtggagaacttcttgccaactccctcc
aaatcacattatgtctttaaccttcgggatttctcacgggtgatccagggagtgctgctg
tgcccccacacccacctacaggatttggaaaaatttatccggctttggatccatgaagtt
taccgagtcttttatgaccgcctgattgacaatgatgacaggcagactttcttcaacttg
gtgaaggaaaccacttccaattgcttcaagcagactgtggagaaggtgctcatccacctg
tcacccactggcaaaataactgatgaaaacatccgtagcctcttctttggggattttttg
aagccagaaagtgaccaaaaaatctatgacgagatcattgacctgagaaacctcacggtg
gtgatggagtactatctggatgagttcaacagtgtcagcaaggctcccatgtctttggtc
atgttcaagtttgccattgagcacatctccaggatctgcagagtcctaaagcagaacaaa
ggccacctgctcctggtgggcattgggggcagtgggcggcagagtgccaccaaactgtcc
acgttcatgaactcctatgagttataccagattgaaatcacaaagaattataccggcaat
gactggagagaggacctgaaaaagataatgttgcagtcaggagtggccaccaagagcact
gtgttcctcttcgcggataaccagatcaaggacgagtcgtttgtggaagacatcaacatg
ctcctgaacacaggtgatgtgcccaatatcttcccagctgatgagaaggctgaccttgtg
gaaaagatgcagacagcagccaggacgggaggagagaagattgaagtcactcccctgtcc
atgtacaacttcttcatcgagagagtgagaaagaaccttcacattgttcttgccatgagt
ccgattggggatgccttcaggacccgcctgagaatgttcccttcacttatcaactgctgc
acaattgactggttccagtcctggccaaccgatgccttagagttggtggccaacaagttc
ctggaggacgtggagcttgatgacaacattcgggcagaggtcgtctccatgtgcaagtac
tttcaggagagcgcgaagaagctctcagttgattactacaacacacttctcagacacaac
tatgtgacccccacctcctaccttgaattgattctaaccttcaagacgctcctgaatagc
aaaagacatgaggtggacctgatgaggaaccgctacttggcaggcttgcagaaactggaa
tttgcatcttcccaagtggctgtcatgcaggtagagctgaccgcccttcagcctcagctc
atccagacctcagagaatacagcgatgatgatggtgaaaattgaaatggagacaaaagaa
gctgatgccaagaaactgctggtgcaggcagatgagaaggaggctaatgctgctgctgcc
gttgctcaggcaatcaagaatgaatgtgagggagacctggctgaggccatgccagcactt
gaggctgcacttgctgccctggacaccctgaacccagctgacatcacactggtgaagtcc
atgcagaacccaccaggccctgtcaaactggttatggagagcatttgcgtcatgaagggg
ctgaagccagagaggaagccagaccccagtggctctggtaaaatgatagaagattactgg
ggagtatcaagaaagatccttggagatctaaagttcttggaaagtctcaagacgtacgac
aaagacaacatctctccggtgatcatgaagcggatccgggaaaggtttattgatcaccct
gatttccagccagctgtcattaaaaatgtatcatctgcctgtgagggcctgtgcaagtgg
gtgagggccatggaagtgtatgaccgagtggccaaggtagtggctcccaaacgggagcga
ctgagggaggctgaggggaagctggagatacagatgcataagctgaaccagaaacgggca
gagctgaagctggtggaggaccgactccaagctctgaatgatgagtttgaactgatgaac
agtaagaaaaatatgctggaggaaaatatagaaatctgctcccagaagctcatcagggca
gaaaagttgattagtggtcttggtggcgagaaggacagatggacagaagctgcccggctg
ctggggatccgctatgataacctaacgggggacgttttgttgtcctctggtactgtggct
tacctgggtgccttcacggtggattatcgggcccaatgccaaacggaatggttgatttcc
tgtaaggacaaggtcatcccaggctctgttgacttcagcctcagcaacaccttaggggat
cccataaaaatccgtgcctggcagatagcagggcttcctgttgattccttctctgttgac
aatggcatcattgtgtccaattccagacgttggcccttaatgattgaccctcagggacag
gccaataagtgggtgaagaatatggaaaaaacaaacaagctatctgtcattaagttttct
gatactaattatgtgaggactctggaaaatgccctgcagtttggcacccctgtcttgttg
gaaaatgttggagaagagctggatgcctttattgaacccatcttgctcaaggcaacattc
aaacagcaaggagtagagtacatgagactgggtgaaaatattattgaatattcaagggaa
tttaaattctatataaccacccgtctgaggaatccgcattatctccctgaagtggcagtg
aaagtctgtctcctcaacttcatgatcacacccttgggtctccaagatcaacttcttggt
attgtggctgccaaggagaagccagagctcgaagagaaaaagaacaagttaattttagaa
agtgctgagaataagaaacagctaaaggaaattgaagataagattctagaggtcctatcc
ctgtctgagggcaacatccttgaagatgagacagccatcaaagttttgtcctcttcaaaa
attctgtctgaagaaatctctgagaagcaagaaatagcctctgtgacagaaacacaaatt
gatgagacccggatgggctacaagcctgtggctattcattctgctgccatctttttctgc
atctctgatctagcccacattgagcctatgtaccagtattctctgacatggttcatcaac
ctctatgtgctgtctctagcaaatagcaacaagagcgatgaactggatctgcggattgag
tacatcatcgaacatttcactctcagcatctataacaatgtgtgccgctcactgtttgag
aaagataagctacttttctccctcctcctgaccattggcctcttgaaggaaaaaaaggca
atcgatgaggaagtttggtacttccttttaactggaggtgtggccctggataatcctttc
cccaacccagctccagaatggttatcagagaagtcatggggtgagattgttcgagcttcc
tccttaccgaaactcaaaggtctgatggatgatttgtcacggaatctgacagaatggaag
gcaatctatgactcagcctggccacaagacgagtcactaccttccccttgggtattcctt
caagcactggaaaagatggcaatcttgcgatgtttgcggcctgacaagatagtcccagcc
attcaagacttcatctctgaaaccatgggaaaggtattcatcgaagccccaacttttgat
ctccagggatcctacaatgattccagctgttgtgcaccactgattttcatactgtctcca
ggtgcagaccccatggcaggtctgctgaagtttgctgatgatcttggcatgggaggtacc
aaaacacagacgatctcccttggtcaaggccaaggtcctattgctgccaaaatgatccac
aaagccatccatgaagggacctgggtggtcctacagaactgccacctggctacaagctgg
atgcctgcactagagaagatctgtgaggaggtgattattcctgagaacaccaaccgggat
ttcaggctctggctaaccagctatccatcagagaaatttcctgtcagcattctccagaat
ggaatcaaaatgaccaatgagcccccaaaaggactcagggccaaccttctgcgttcctac
ctcaatgatccaatctcagaccctgtgttcttccagagctgtacaaagccagttatatgg
cagaaactgctgtttggactttgcttcttccatgccatcgtccaggagaggaggaactat
ggagccctaggttggaacattccttatgaattcaatgaatctgacctgaggattagcatg
cggcagatccagatgtttctcaatgattacaaagaggtgccttttgaggctctgacctac
ctgacaggggaatgtaattatggaggcagagtgactgacgacaaagacaggcgtctcctg
ctgtccctgctgtccacattctactgtaaggaaattgagacagatcactactacattgct
ccaggacagccgtacttcatccctccccacggctcctaccagtcatacattgagtacctc
aggaccctccccatcacagcacaccctggagtatttggtctccatgagaatgctgacatc
accaaggacaaccaggaaaccaaccagctcttccaaggagtgctgttgactctgccaaga
cagtctggagggagtgggaagtctcctcaggaagtggttgaggagctggcccaggatata
ctctccaagcttcccaaagactttaacctggaagaggtcatgaagttgtaccctgtggtc
tatgaggagtctatgaataccgtcctaaggcaggagctcatcagattcaacaggctgacc
aaagtggttcgcagaagccttattgatcttggccgagccatcaaagggcaagtcctaatg
tcctcagagctggaggaagtcttcaatagtatgatcgtgggtaaagtgccagccatgtgg
gcagccaagtcctacccatcactgaagcccctggggggctacgtggctgacctattggcc
cgcctggccttcttccaggaatggatcaacaaaggcccccctgtggtcttttggatctct
ggattctacttcacacagtcctttttgacgggagtttctcagaattatgccaggaaatat
accatccccattgaccacattggatttgaatttgaggtaacatcaaaagaaacaacaatg
gagaatatcccagaagatggggcctacatcaaaggacttttccttgagggtgcccgttgg
gacaggacaatcaggcagattggagaatctctccccaaaatcctctatgacccattgccc
atcatttggctgaaacccggagagagtgcatcattcctgcatcaggacatttacgtgtgt
ccagtgtataagacgagtgctcggagaggcaccctctctaccactggccactctactaac
tatgtcctgtccattgagcttccaacagacatgccccaaaagcactggataaaccgaggc
gtggcctcgctgtgccagctggataactga

KEGG   Rattus norvegicus (rat): 117250
Entry
117250            CDS       T01003                                 

Gene name
Dnah6
Definition
(RefSeq) dynein heavy chain 6, axonemal isoform X1
  KO
K10408  dynein heavy chain, axonemal
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    117250 (Dnah6)
   05016 Huntington disease
    117250 (Dnah6)
   05022 Pathways of neurodegeneration - multiple diseases
    117250 (Dnah6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    117250 (Dnah6)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     117250 (Dnah6)
SSDB
Motif
Pfam: AAA_6 DHC_N2 AAA_8 Dynein_C AAA_9 AAA_7 AAA_lid_11 MT Dynein_heavy Dynein_AAA_lid AAA_5 AAA_lid_1 AAA AAA_18 AAA_22 AAA_16 TsaE Sigma54_activat T2SSE Utp12 DUF853 NB-ARC
Other DBs
NCBI-GeneID: 117250
NCBI-ProteinID: XP_038964640
RGD: 621797
Ensembl: ENSRNOG00000015581
Position
4
AA seq 4156 aa
MESLRKDGFRIRMAFQGTENEIDLKSMENQEEENPVLTRLNKIRAKGVLNYASLKENEPE
PQTLVFRHTTKAQEKTRKRQQPVKLEPLPVLKLYQDHKQPEYIYEQNRQQLMSTGILKPS
PSMIERSSIGSLEAQEALKRKQVLRPSADVFSLSPSKLPRTSIGRRGLFGMRSSTYPKYT
FNDREEVVKANIRDPLQIIKIVHENEHLGFLYMIPAVPKSSIEYDTYNLKVVSYENINKN
DYYTISKDAVTHVFNDDIEYIETERWEQEYLYHRELTKIPIFSLFRKWKAFSVWRKNVRS
KKITGCRKALRKNLFIVNPYLRPALLKINDMCYQLSFMGLCYIEKFHTYTLQEFKAAQVV
RVQEVTERLEYFRFEAKDVVRKSCRFALRAAGFIPDDCEVETHEDYFKINIASFIDAPSD
LPTYGESEKMTYTEQASKRHHCMRLTCFIRLNDYLIQNTLHVLTVNTASSLLNYLSDKLK
RTPSADVIQKWITEDKPEVIEKKGAPMMEKQEEDESLIPMFLTELILTVQSLLFEPSLED
FLDGISGIINHFENTVLSVPNLVPDSYFNAFTSPFINKKVEEKTCGPGPSLSAVFEDDRN
FLTIIQQIKETIHSAFDSARLYAATFEKFQIFFKENESLDLEALKEEEPDVEFFSSQLEK
YHKQHKDSVALKPTRNVGLLLIDTKQLKEKLIPSPLRCLEVLNLMLPRLSKKKVDAIISE
AQDAEYKLEFVPTTTIEYVNSLVFLDEIQERIETLEEEGNTVVQMYKLIEQYQVLTPPED
FAVFATMKPSITAVRNAIDKSVGDRESSIKQFCLHLGRDLEDLNNEVNEVKLLAQDPQIL
DISADPEKIKTMLSDLQSVLDDLQKRAFQYKSYQKNFKVEVSKFDALEEVCAELRLKQLL
WDSLSEWDKLQQEWLKSKFDCLDPEVLNGQVTKYAKFVTQLEKGLPPNSVVPQLKQKVER
MKEKLPVINDLRNPTLKPRHWSAIEQTVDALLVDIEIPLTLERLSELHVFDFAQEIQDIS
GQASGEAALEIILKKVEDSWKTTEFVILPHRDSKDVFILGGTDDIQVLLDDSTINVATIA
SSRYVGPLKTRVDDWQKQLSLFNQTLEEWLNCQRNWLYLESIFNAPDIQRQLPAEAKMFL
QVDKSWKEIMRKVNRLPNALRAATQPGLLETFQNNNALLDQIQKCLEAYLESKRVIFPRF
YFLSNDELLEILAQTRNPQAVQPHLRKCFDSISKLEFALMPPTEGKIPGIDTEPEKVFTN
DILAMLSPEGERVGLGKGLKARGNVEEWLGKVEEAMFSSLRRLCKAAIADYQGKLRTEWV
IAGHPSQVILTISQIMWCRDLTESLECEDNHLEALEKFEQVNFERLNALAAIVRGSLPKL
HRNIITALITIDVHARDIVSELVQSKVDSAESFDWQRQLRYYWDVDLDNCVARMALSQYT
YAYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQC
VVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKLS
RFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPMAMMVPNYALIAEVILYSE
GFESSKILARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPDLSEDVVLI
RALRDSNLPKFLTDDALLFSGIISDLFPGVQIPEHDYGILHSTIVDVMISQNLQPEICMV
KKVIQLYETMLVRHGVMLVGPTGGGKTTVYQVLAETLGNLEKLNTGNPFYQPVKTFVLNP
KSITMGELYGEVNNVTLEWKDGLMALSVRAAVNDTSEDHKWIISDGPVDALWIENMNTVL
DDNKMLCLANSERIKLTPQVHMLFEVQDLKVASPATVSRCGMVFVDPEELKWMPYVKTWM
STLSKKLSEEIREYLLNLFNRYVDDGLRFVNKKCTQAIPQVDISKVTTLCCLLESLLLSK
DGNILSLEQMKLNTVVCQTFVFCYLWSLGGNLTENHWDSFDTFIRTQFDDNPDARLPSSG
DLWSIHVDFDTKRLDPWERIIPTFKYSREVPFFEMLVPTADTVRYGYLMEKLLAVRHSVL
FTGTTGVGKSVIAKGLLNRIQESAGYVPVYLNFSAQTSSARTQEIIESKLERKRKNILGA
PGNKQVVIFVDDLNMPRLDRYGSQPPIELLRQYQDFGGFYDRNKLFWKEIQDVTIVSACA
PPGGGRNPVTPRFIRHFSMLCLPMPSEHSLKQIFQAILNGFLADFTEAVKQTSSNIVEAA
VEIYNRMSVDLLPTPAKSHYVFNLRDLSKCVQGILQCDPGTIREEMQIFRLFCHECQRVF
HDRLINNEDKHYFHVILTEMANKHFGIAIDLEYFLSKPIIFGDFIKFGADKADRIYDDLP
DIEKIENVLQDYLDDYNLTNPKEVKLVFFQDAIEHVSRIARMIRQERGNALLVGVGGTGK
QSLTRLAAHICGYKCLQIELSRGYNYDSFHEDLRKLYKMAGVEDKNMVFLFTDTQIVVEE
FLEDINNILNSGEVPNLFEKDELEQVLAATRPKAKEVGISEGNRDEVFQYFISRVRQKLH
IVLCMSPVGEAFRSRCRMFPSLVNCCTIDWFVQWPREALLSVSKSFFSVVDTGNEELKEK
LSLMCVNVHLSVSHMADRYYSELRRRYYTTPTSYLELINLYLTMLTEKRKQLVSARDRVT
NGLTKLLETNILVDKMKLDLSALEPVLFQKSQDVEALMEKLVVDQESADQVRNVVQEDEA
IAKVKAEETQAIADDAQRDLEEALPALEAANKALDSLDKADISEIRVFTKPPDLVMTVME
AISILLNAKPDWPTAKQLLGDSNFLRRLLEYDKENIKPQILSKLQRYINNPDFVPEKVEK
VSKACKSMCMWVRAMDLYSRVVKEVEPKRQKLRAAQAELDATITTLKEKQALLKQVEEQI
RALQEEYDKGVNEKESLAKTMALTKARLVRAGKLTAALGDEQVRWEESIEKFQEEIANIV
GNVFIAAACVAYYGAFTAQYRQLLIECWIDSCLALDIPIDPSFSLINTLGDPYEIRQWNA
DGLPRDLISTENGILVTQGRRWPLMIDPQDQANRWIRNKESKSGLKVIKLTDTNFLRILE
NSIRLGLPVLLEELREVLDPALEPILLKQTFMSGGRLLIRLGDSDIDYDKSFRFYMTTKM
PNPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPELEGQRVQLIVRINSDKNQLK
SIEDKILKLLFTSEGNILDNEELIDTLQDSKITSGAIKTRLKEAESTELMINIARERYRP
VATQGSVMYFVIASLSEIDPMYQYSLKYFKQLFNTTIETSEKSDSLQERLAILLQQTLLT
AYTNVSRGLFEQHKLIYSFMLCVDIMRQQEQLTEAEWNFFLRGSAGMEKERPPKPEAPWL
PIQMWFSCCDLEEWFPIFEGLTRHILLHPISISLGSFETYINPQSWEGYPKQRHEEEKEH
VWGSNFSSFHKLILVKCCKEEKVVFALTDFVIENLGKQFIETPPVDLATLYQDMSSSTPL
VFILSTGSDPMGAFQRFARESGYAERVQSISLGQGQGPIAEKMIKDATKSGNWVFLQNCH
LAVSWMLAMEELIKTFTDPNQSIKDTFRLFLSSMPCSTFPVTVLQNSVKVTNEPPKGLRA
NIRRAFTEMTPSFFEENILGMKWRKLIFGICFFHAIIQERKKFGPLGWNICYEFNDSDRE
CALLNLNLYCHEGKIPWDALIYITGEITYGGRVTDTWDQRCLRTVLKRFFSPETLEDEYT
YSESGIYFAPLADSLQEFKDYIEDLPLIDDPEIFGMHENANLVFQYKETNTLITTILEVQ
PRSSSGGEGKSNDEIVQELVASIRTRVPESLQMEGASETLFVKDPQGRLNSLTTVLGQEV
DRFNNLLKLIHISLETLNKAIAGLVVMSEEMEKVYQSFLNNQVPSLWSNTAYPSLKPLGS
WVKDLILRTAFVDLWLKRGQPKSFWISGFFFPQGFLTGTLQNHARKYNLPIDELSFKYNM
IPVYRDQALVIEAAKDIQFGTELPMDKELPTPEDGVLVHGMFMDASRWDDKDMIIEDALP
GQMNPMLPVVHFEPQQNYEPIQTLYHSPLYKTGARAGTLSTTGHSTNFVVTVLLPSKRPS
DYWIAKGSALLCQLSE
NT seq 12471 nt   +upstreamnt  +downstreamnt
atggaaagcctcagaaaggatggattcagaataaggatggctttccaaggcacagagaat
gaaatcgacctgaaaagcatggaaaaccaggaagaagaaaatcctgtgcttaccagacta
aacaaaataagagcaaaaggggttctgaattatgcatctctcaaagaaaatgaacctgaa
ccccaaaccctggtatttaggcacaccacgaaagctcaggagaagaccagaaagcgacag
cagcctgtgaaactggagcctctgccagtgctaaaactctaccaagatcataagcagccc
gagtacatatatgaacagaatcggcagcaactcatgagcactggaattctaaagccatca
ccaagcatgattgaaagatcttcaattggtagtcttgaggctcaagaagctctgaaaagg
aaacaggtccttcgaccctctgcagatgtgttctctctttctccatctaaactgccacgc
acgagtattggaaggagagggctctttggaatgaggtcttcaacttaccctaagtacacc
ttcaatgaccgagaagaagtcgtcaaagccaacatcagagatcccttgcaaatcatcaaa
atagtgcatgagaacgaacacctcggattcctgtacatgattcctgcagtgcccaagtct
tccattgaatatgacacatataatctaaaggtcgtaagttatgagaacatcaataaaaat
gactactacacaattagcaaagacgcagttacccacgttttcaacgatgacatcgagtac
atcgagactgagcggtgggaacaggagtacctgtaccacagagagctcacgaagatcccc
atattctcactcttccggaagtggaaggctttcagcgtgtggcggaaaaacgtgcgctcc
aagaaaatcactggctgtcgaaaagcgcttcgaaaaaacctgttcattgttaatccttat
ctccgaccagctcttcttaaaattaatgacatgtgctatcaactgagctttatgggactt
tgttacattgaaaaatttcacacctacaccctgcaggaattcaaggctgcacaagtcgtg
cgagtacaggaggtgacagagcgcctggaatatttccgattcgaggcaaaagacgtggtc
aggaagtcgtgccgcttcgccttacgtgctgcgggatttattcctgacgactgtgaagtg
gaaactcatgaggattactttaagatcaacattgcaagttttatcgacgctccgtctgat
ttacccacttacggagaatctgaaaaaatgacctacacagaacaggccagcaaaagacat
cactgcatgaggctcacatgcttcatccgtctgaatgattacctaattcagaacaccttg
cacgtcttaacggtaaatactgccagctcccttctgaattacctctcggataaactaaag
cgaactccctcagcagatgtcatccagaagtggattactgaagataagcccgaagtcatc
gagaaaaagggggccccaatgatggaaaagcaggaggaagatgagtctctcatccccatg
ttcctcacagaactgattctgacggtgcaatcattactcttcgagccttctttggaagac
tttctggatggcatttctgggataattaaccactttgaaaacacggtgttgtcagttcct
aatctggtgccggactcttactttaacgctttcaccagccctttcattaacaagaaggtt
gaggagaagacctgtggcccggggccgagcctctcagccgtgtttgaggatgatcggaac
tttctcaccatcatccagcaaataaaggaaacgattcactcagcgtttgactctgcacgc
ctgtacgcagcgacattcgaaaagtttcagatattcttcaaggaaaatgagagtcttgat
ctggaggcactgaaggaggaggagcctgatgtcgaattcttcagttcccagctggaaaaa
tatcacaaacagcacaaggactcggtagccttgaaacccacccgaaatgtaggcctgctg
cttattgataccaagcagctgaaggagaagctaatcccatcaccactgcggtgcttggaa
gtgctaaatctcatgcttccccgtttgagcaagaaaaaggtggatgctatcatctcagag
gcacaagatgcagagtataaactcgagtttgtgccaaccaccaccatcgagtacgttaac
agcttagtgttccttgacgaaattcaggagcggattgaaaccctggaagaggaagggaat
acagtggttcagatgtacaagctcatcgaacaatatcaggtgctcacaccccctgaagac
tttgcggttttcgccactatgaagccatccataactgcggtgcggaacgccattgacaaa
tctgtgggtgatcgagaatccagcatcaaacagttttgtctgcacttgggtcgggatctg
gaagatctcaacaatgaagtgaatgaggtgaagctgctggcacaggacccacagatcttg
gatatcagtgctgacccggagaaaataaagacgatgctgagtgacctgcagtccgttctg
gatgaccttcagaaacgtgcctttcagtacaaatcctaccagaagaatttcaaggtggaa
gtgtccaagtttgatgcattggaagaagtctgtgctgaactaaggctcaaacaactgctc
tgggattccttgtctgaatgggataaactccagcaggagtggctaaagtccaaatttgac
tgcttggacccagaggtcctaaacggtcaagtcactaaatacgctaaatttgtgacccag
ctggaaaagggcttgccacctaacagtgtggtgccccagctcaaacagaaggtggagaga
atgaaagaaaagcttcctgtgatcaatgatttgaggaacccaacactgaaacctcggcac
tggtcagccattgaacaaaccgttgatgccctcttagtggacattgaaattccgctgacc
ttagagaggctgtccgaactacacgtctttgattttgctcaagaaatccaggacatatct
ggacaggcttctggggaagctgccttagagataattcttaagaaggtggaagactcttgg
aaaacgacagaatttgtcattcttcctcaccgtgactcgaaggacgtatttatcctgggt
ggcacagatgacatacaggtccttcttgacgatagcaccatcaacgttgcaaccatcgcc
tcatcacgatatgtgggtcccctaaagactcgagtggatgactggcagaaacaactttcc
ttgtttaatcaaacactggaagagtggctgaactgtcagagaaactggctctacctagaa
agcatctttaatgccccagatatccagaggcagctgcctgcagaagccaagatgttcctt
caggtggataagtcatggaaggaaatcatgaggaaggtcaaccggctgcctaatgcgctc
cgggctgcaactcagccagggcttctggagacttttcaaaacaataatgcattacttgac
caaattcagaaatgtctggaggcatatttagagtcaaagagagttatcttcccaaggttt
tacttcttgtcaaatgacgagctcctggagattttggcccagacccgaaatccacaggct
gtgcagcctcatctaaggaaatgcttcgactccatttcaaagctcgagtttgctctcatg
cctcccacagaagggaaaataccaggcattgacactgagccagaaaaggtcttcaccaat
gacattttggcaatgctctcacctgagggagaacgggttggcctggggaaaggcctcaag
gcgagaggcaatgtggaagaatggcttggtaaggtggaggaagccatgttctcatctctc
cgccgcctgtgcaaagctgccatcgctgattaccaggggaaactcaggacagagtgggtg
atcgctggccacccttctcaagtgatcctgaccatttctcagatcatgtggtgccgggat
ttgaccgagagtctagaatgtgaagataatcatttggaagccctggaaaaatttgaacaa
gtgaattttgagagattaaatgccctggccgcaatagttcgaggcagtcttcctaaatta
cacagaaacatcataactgcattgatcaccattgatgtgcatgcaagagatatagtttct
gaattggttcaatccaaggtagactcagcggagtcctttgactggcagcggcagctgcgc
tactactgggacgtagacctggataactgtgtggctagaatggcgctatctcagtacacc
tatgcctacgagtacttgggagcatgcccgagactggtcatcactccgctcacagatcgc
tgctatctttgcctcatgggggctttgcagcttgacctcggaggcgcaccagctggccct
gctggcactgggaaaacagagactactaaagacctagcaaaagcgcttgccatccagtgt
gtggtcttcaactgctctgacggtttggactacaagatgatggggcgcttcttcagtggt
ttggcacagtcgggggcctggtgctgctttgacgaattcaatcggatcgatatagaagtc
ctgtcggtcattgcccagcaactcatcaccattaggaatgccaaagctgcaaagctctcc
agattcatgtttgagggacgggaaatcaagctcgttatgacctgtgcagctttcatcacc
atgaatccgggctatgcaggcagaacggaacttccagataacttgaaggccctgttcaga
ccaatggctatgatggttcccaattacgcactgattgcagaggtgattctgtattctgaa
ggatttgagtcgagtaaaatactggcaaggaagatgacacagatgtacaagctctgcagt
gagcagctgtcccagcaggatcactacgactttggcatgagggccgtcaagtctgtactg
gtcatggctggatctctaaaaagagagaacccagacctcagcgaagacgtggtcctgata
agagcgttgcgagactccaacttgcccaaattcttaacagacgatgctctcctgttcagc
ggtatcatatctgatctttttcctggagtccaaatcccagaacacgactatggtattttg
cattcaacaattgtggatgtcatgattagccagaaccttcagcctgagatatgtatggtc
aaaaaggtgatacagttgtacgaaaccatgctggtaagacacggcgttatgttagtagga
ccaacgggaggtggcaagaccacagtttatcaagtattagcagaaaccttggggaatctg
gaaaaactcaacacaggcaatcctttttatcagccagtaaaaacctttgttcttaatccc
aaatcaatcaccatgggagaattatatggggaagtcaataacgtgaccttggaatggaag
gacggtctgatggcactaagtgtccgagcagctgtgaatgacacttcagaagatcataag
tggataatcagtgacgggccagtggatgctctctggattgaaaatatgaatactgtgttg
gatgacaacaagatgctgtgcctggccaacagtgaaaggatcaagctcaccccgcaggtc
cacatgctttttgaggtacaagatctgaaggtggcctctccggccacagtcagccgatgt
ggaatggtgtttgtggatccagaagaactcaagtggatgccttacgttaaaacatggatg
agcaccctctctaaaaagctgagtgaagaaatccgagaatatttattgaatcttttcaat
cgttatgtcgatgatgggttacgttttgtaaacaaaaagtgcacccaagctatcccacag
gtggacatcagcaaagtgaccacactctgctgcctactggagtctttgctgctcagcaaa
gatggaaatatcttgtcactggaacaaatgaagctgaacactgtagtgtgccagactttt
gtgttctgttatttgtggtctttgggtggaaacttaactgaaaatcactgggattctttt
gatacgtttattagaacacaatttgatgataatcctgatgccaggcttcccagctctgga
gatctgtggagcattcatgtagactttgacaccaaacgcctggacccctgggaacgaatc
atacccaccttcaagtacagcagggaggtcccgttctttgagatgcttgtcccaacagca
gacacggtgcggtacggctatctaatggaaaagctgctggcggtcaggcactcagtgttg
tttactggaacaactggagttggcaagtctgttattgcaaaaggattgctgaataggatt
caagaatcagctggctatgtccctgtttatctaaatttctctgcccaaacctcatccgca
aggacacaagagatcattgagtcaaaactggaacgaaagagaaaaaatattttaggagca
ccaggaaataaacaagtggtgatttttgttgatgatctgaatatgccccggctggatcgc
tatggctcccaaccaccgattgaactgcttcggcagtatcaagactttggtggattctat
gatagaaacaaactcttttggaaagaaatacaggatgtaacaattgtatcagcatgcgca
cctccaggagggggtcgcaatcctgtgacaccccgcttcattcgacacttcagcatgctg
tgcctccccatgccctcagagcacagtctgaagcagatttttcaggccatcttgaatggc
ttcctggctgactttacagaagcagtaaagcaaacttcatcaaacattgtagaggccgca
gttgagatttataacaggatgagtgtcgatctcctgccaaccccagccaagtcccattac
gtctttaacctgagagacttatccaagtgtgtgcaaggtattctccaatgtgacccggga
acaataagagaagaaatgcagatatttagactattttgccacgaatgtcagagagtgttc
catgaccgcctgatcaataacgaagacaagcactacttccatgtcattttgacagaaatg
gccaacaagcactttgggattgcgattgacctggaatacttcctaagcaagcccatcata
tttggtgatttcattaagtttggagcagataaggctgaccgcatctacgatgatttacct
gacatagagaaaatcgagaatgttcttcaggactatctcgacgactataacctcacaaac
cccaaggaagtgaagctggtgttcttccaggatgccatagagcacgtgtcaagaatcgca
cggatgatccgccaggaaaggggcaatgcactgctggttggtgtaggaggcacgggaaag
cagtccctcacgagacttgccgctcatatatgtggttacaagtgtttgcagatcgaactt
agccgggggtataattatgacagtttccacgaagacctgaggaagttgtacaagatggct
ggtgtggaagacaaaaacatggttttccttttcacagacacccagatcgtcgttgaagag
ttccttgaagacataaacaacatcctcaattcgggtgaagtgcccaatttatttgagaag
gatgagctggagcaggttttagcagccacccgaccgaaagccaaggaagttggaatctct
gaggggaacagagatgaggtgtttcaatatttcatcagcagagtacgacagaagctgcac
atagttctctgcatgagcccggttggcgaggccttcaggtcccgatgccggatgtttcca
tccctggtgaactgctgcaccattgactggtttgtccagtggcccagagaagcgcttctg
tccgtatcgaagtcatttttctcagttgtcgacactggaaacgaagaactaaaagaaaaa
ctttccctcatgtgtgtgaacgtgcacctgagtgtctcccacatggcagatcgctactac
agcgagctgcgcaggcgctactacaccacgcccacctcctacctggagctcatcaatctc
tacctgaccatgctcactgaaaagaggaaacagctagtttcagcacgagatcgtgtaacg
aatggtctcaccaagctattagaaacaaatatattagtagataaaatgaaattagacctt
tcggctttagaacctgtgctattccagaaatcacaagacgtcgaagccctgatggaaaaa
ctagtggtggaccaagaaagtgctgatcaggtccgtaatgttgtgcaagaagatgaagca
atagcaaaggtgaaagctgaagagactcaagcgattgctgatgatgcccagagagacctg
gaagaggcactccctgcccttgaggctgccaataaagcactggattccttagacaaagca
gatatctctgaaatccgagtcttcacaaagccccctgacttggtcatgactgtgatggaa
gccatctccatcctcttaaatgccaagccggactggccaacagcaaagcaacttcttggt
gactctaactttctaagaaggcttttagaatatgataaggaaaacataaaacctcagatt
ctgtcaaagcttcaaaggtacatcaacaaccctgacttcgtgcctgaaaaggtggaaaag
gtgtccaaggcctgtaaatccatgtgcatgtgggtgagagccatggatctgtactctcgg
gtggtcaaggaagtcgaaccaaagagacagaaactccgtgctgcccaggctgaacttgat
gctacaataactactctgaaagaaaagcaggcattgctgaagcaagtggaagagcaaata
agggctttgcaagaggagtacgacaaaggcgtgaatgagaaagaaagtctggcaaagacc
atggccctgaccaaagcgcgcctggtacgggctggaaagctgacggctgcattgggagat
gagcaggtccggtgggaagaaagcattgagaaattccaggaggagatcgcaaacatcgtt
ggaaacgtgtttatagcagccgcgtgtgtggcttattacggggccttcacagcccagtat
aggcagttgcttatagagtgctggattgactcctgcctggccctggatatccccattgac
ccctccttcagcctcattaacactcttggcgatccctacgaaatccggcagtggaatgca
gatgggctgcccagagacttgatatccactgaaaatggcattttggttactcaggggaga
aggtggcctttgatgattgatccccaagatcaagccaatcgctggataagaaacaaagaa
agcaagagtgggttaaaggtcattaagcttacagacaccaatttcttacgaatactggaa
aattccatccgactgggtttacctgtcttactggaagagctcagggaagtcttggatcca
gccctggagcccatccttctaaagcagactttcatgagtggcggaagactgctcatccgc
ctcggagattcagacatcgattacgacaagagtttcaggttctacatgaccaccaaaatg
ccgaatccccactacctgcctgaggtgtgcattaaagtcaccatcatcaacttcactgta
actaagtcgggtctggaggatcagttgctaagcgatgtagtgcgacttgaaaaacctgag
ttggagggacagagagtccagctcatcgtgaggatcaatagtgataaaaaccagctgaag
tccattgaagacaaaatcctgaaattgctctttacatctgaagggaatattctggataac
gaagaacttattgatacactccaggactcaaagatcacttcaggtgccattaaaaccagg
ctgaaggaagcagagtccaccgagttgatgatcaacatagctcgagagaggtaccgccca
gtggccacacagggctccgtgatgtactttgtgatcgccagcctctcagaaattgatccc
atgtatcagtattcactgaagtactttaaacagttgttcaacacaacaatcgaaacgtct
gagaagagtgacagcctgcaggagcgcctggcaatcctcctgcagcagaccctcctcact
gcgtacaccaatgtttcccggggactcttcgagcagcacaagctcatctacagcttcatg
ctctgcgtcgacatcatgcgccagcaagagcagctaactgaggccgagtggaatttcttc
ctccgaggttctgcagggatggagaaggagcgccctcctaagccagaagctccctggctg
cccattcagatgtggttctcctgctgtgacctagaagaatggtttccaattttcgaagga
cttacaagacatatactgttgcatcccatctctatatccttaggatcttttgagacctac
attaacccacagagctgggaaggataccctaagcagagacacgaagaggaaaaggaacac
gtttggggatcgaacttcagctctttccataagttaattcttgttaaatgctgtaaagaa
gaaaaggtggtttttgctctcactgactttgtgatagagaatcttggcaaacaatttatt
gagacacctccagtggacctggccactctgtatcaggacatgtcaagcagcaccccactg
gtgtttatcttgagcacaggctctgatcccatgggtgcctttcagaggtttgccagggag
agcgggtatgcagaacgagtgcagtcaatttcactgggacaagggcagggccccattgct
gagaagatgatcaaggatgccacgaaatccggaaactgggtatttctgcagaactgccat
cttgccgtttcttggatgctggcaatggaagagctgatcaaaaccttcacagacccaaat
cagtccatcaaggacactttccggctctttctaagctccatgccttgttccacatttcct
gtgacagtccttcagaattctgtcaaggtaaccaatgagcctccaaaaggcctgcgtgca
aatatcagacgagcctttactgaaatgacaccttcgttttttgaagaaaatatacttgga
atgaaatggagaaaactaatattcggcatttgtttcttccacgcaattattcaggagagg
aagaagtttggccccctgggctggaatatctgctatgagtttaatgacagtgacagagaa
tgtgccttactgaacctcaacctctactgtcacgaagggaagatcccctgggatgcgcta
atttacatcactggtgagatcacctatggcgggagagtgacagacacctgggatcagaga
tgccttcgaactgtcctgaaaagatttttctctcccgaaacattggaggatgagtatacg
tactctgaatcaggcatctattttgcccccttggctgacagcctccaagagtttaaggac
tacattgaagatctacctttgatagatgatccagaaatctttggaatgcatgaaaatgct
aacctagtgtttcagtacaaagagaccaacactctaatcaccaccatccttgaggttcag
ccaagatcctcctctggcggagagggcaaaagcaatgatgaaattgtccaggagcttgtt
gcttcaatccggaccagagttccagaatccctgcaaatggagggtgcttccgaaaccctt
tttgtcaaggacccgcaagggcgcctgaactctctgaccaccgtccttggccaagaagtg
gaccggttcaacaatcttctgaagttaatacatatttctctagaaacactcaacaaagcc
attgcaggactcgtggtgatgtctgaagaaatggaaaaagtgtatcagagtttcctcaac
aaccaggttccctctctttggtctaacacagcctacccatccctgaagccactgggatca
tgggtcaaagaccttattctgaggactgcattcgtggacctgtggctcaaaagaggacag
cccaaatccttctggatctccgggttcttctttcctcaaggatttctcacaggaactctc
cagaaccatgctcgaaaatataatttgcctatagacgagctgagtttcaaatataacatg
atcccagtctaccgagatcaagccttggtgatagaagcagccaaggacattcagtttgga
acagaactgcccatggacaaggagttgcccactccagaggatggggttctcgttcacggg
atgttcatggatgcttctcggtgggatgacaaggacatgatcatagaagacgcattgcca
ggacagatgaaccccatgctgcctgtagtccactttgaaccgcaacaaaattacgagcca
atccaaacactctaccactccccgctctacaaaacaggagcccgggcaggaacactttca
accacaggtcattcaaccaacttcgtggtgactgtcctcttaccctccaagaggcccagt
gattactggatcgccaaggggtcagcattgctctgccagctgagtgagtga

KEGG   Rattus norvegicus (rat): 117251
Entry
117251            CDS       T01003                                 

Gene name
Dnah9
Definition
(RefSeq) dynein heavy chain 9, axonemal isoform X1
  KO
K10408  dynein heavy chain, axonemal
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    117251 (Dnah9)
   05016 Huntington disease
    117251 (Dnah9)
   05022 Pathways of neurodegeneration - multiple diseases
    117251 (Dnah9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    117251 (Dnah9)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     117251 (Dnah9)
SSDB
Motif
Pfam: MT DHC_N1 AAA_6 DHC_N2 Dynein_C AAA_8 AAA_9 AAA_7 AAA_lid_11 AAA_lid_1 Dynein_heavy Dynein_AAA_lid AAA_5 AAA_16 AAA_30 AAA_29 Sigma54_activat LppA
Other DBs
NCBI-GeneID: 117251
NCBI-ProteinID: XP_002727768
RGD: 621799
Ensembl: ENSRNOG00000004171
Position
10
AA seq 4484 aa
MPGAEEQAVLAESGDEEPGDPRLRLLGTFVARSLRPAAGTWERCAGTAEAGRLLQAFLDH
NAAAGPCPLLVVQSGPGGLVVRPGLDAGPEPNQARAKGLFFLRTRSEPPGNHSLRGTVLC
GDLPAVPLEHLAPLLSEVIIPVLDNEKNHLDWPHMVCQDIRHHAHSLQSDLLVILEHMKG
RTLLPLPVGSEKVEFVDGQSEPVLDSIDKSTVYAMESAVIKWSHQVQVVLKRESSQPLIQ
GEKPTPKVELEFWKSRCEDLEHIYNQLMTIKVRGMAGLLDKLQSSYLPAFKAMFQDVEAA
LTEAQDIRVHLLPLQQHLDILENMEFPEVKGRLRPLLHVVCLIWANCKWYRSPGRLTVLL
QEICNLLIQQASNYLSPEDLLRSEVEESQRKLQIVSDTLSFFKQAFQDRREHLHTYFKED
SEVRAWDFQASLVFVRLDGFLGRLRMVEDLLKTALDFNKLEKLEFSGLRGNSLSQKVQQM
HEEFEEMYKVFLDCSYDCLNPESMEFENDVCGFNKRVEDLDRRLGTILIQAFDDVPEVEH
AFKLLDITGTLVERPLVAQDVSHKYLALIRMFNTELDAVRIIYSQHIREEVEHGFSPVHK
NMPTMAGGIRWAQELRQRIKGPFSNFKNIPHWCLQSAEGKRMIQKYEDLLTLLEEYERRL
YEDWCQTVSEKSQRNLSLPLLHRDPITKQLSVNFNSQLISVLKEMNYLQPTEVKPIPETA
AAMFSSREFYRQLVANLELMANWYNKVITTLLEVEFPLVEEELQNIDLRLRAAEETLSWK
TEGIWDYAMQITNSIHDLERRIQKTKDNVEEIQTIMKTWVSPIFKRKDGKKECPLSLDDQ
QDLLEKYYSLIRESGLKIHALVQENLVLFAADPASSTWKSYVGHIDSMLLDGFFLAIECS
LKYLLENTECKPGLTPIFEAQLNLVTPELVFYPSLDSGVKGGLYDIVQSLVTSIFAVPSL
VPRLSPHSGSPHYQGDLEEMADLASLRSLLLERVQTMMTLCCSYRNTLSQYSYLYVEDRK
EALGQFLLYGHVLTPEEIEAHVEDGIPESPPLLHHFKDQIDSYEKLYEDVVSLEPSKVFD
GWMRVDVRPFKASLLNTIKKWSLMFKQHLVDFVTNSLADLDSFIKSTECGLLKRVEKGDF
QGLVEIMGHLVTLKERQSSTDDMFEPLKQTIELLKSYEQELPETVFKQLEELPEKWKNVK
KMAITVRQQVAPLQANEVALLRQRCSAFDDEQQQFQERFHKEAPFRFDSINPHQMLDVWH
MEIQHMESTMATISKSADLFEVNVPDYKQLRQCRKEACQLKELWDTIGMVTSSIQAWEAT
SWRNISVEAMDSECKQFARQIRNLDKEFRTWDAFTGLESTVLNTLTSLRAVAELQNPAIR
ERHWRQLMQATGVNFTMDRDTTLAHLLQLQLHHFEDEVRDIVDRAVKEMSMEKTLKELQT
TWASMEFQYETHARTHIPLLQSDEDLIEVLEDNQVQLQNLMMSKYVAFFLEEVSSWQKKL
STADSVISIWFEVQRTWSHLESIFIGSEDIRAQLPQDAKRFESIDSDFRELVYDAQKTPN
VVEATNKSGLYEKLEDIQSRLCLCEKALAEYLDTKRLAFPRFYFLSSSDLLDILSNGTAP
QQVQRHLSKLFDNMAKMQFQLDASQNPTKTSLGMYSKEEEYVAFSEPCDCSGQVEIWLNR
VLRHMKATVRHEMTEAVTAYEEKPRDQWLFDYPAQVALTCTQIWWTTEVGIAFARLEEGY
ENAMKDYYKKQVAQLKTLITMLIGQLSKGDRQKIMTICTIDVHARDVVAKMIAQKVDNAQ
AFLWLSQLRHRWDDEAKHCFANICDAQFLYSYEYLGNTPRLVITPLTDRCYITLTQSLHL
TMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFD
EFNRISVEVLSVVAVQVKSIQDAIRDKKQRFSFLGEEISLDPSVGIFITMNPGYAGRTEL
PENLKALFRPCAMVVPDFELICEIMLVAEGFIEARLLARKFITLYRLCKELLSKQDHYDW
GLRAIKSVLVVAGSLKRGDPDRPEDQVLMRSLRDFNIPKIVTDDMPVFMGLISDLFPALD
VPRKRDLDFEAVVRKAIVDLKLQAEDNFVLKVVQLEELLAVRHSVFIVGGAGTGKSQVLK
SLHKTYQIMRCRPVWTDLNPKAVTNDELFGIINPATREWKDGLFSSIMRELANISHDGPK
WILLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLNPTMRLLFEISHLRTATPATVSRA
GILYINPADLGWNPPVNSWIDQREVQTERANLTILFDKYLPTCLDTLRTRFKKIIPVPEQ
SMIQMLCYLLECLLTKEAVPADCPKEIYELYFVFAAIWAFGSSMVQDQLVDYRAEFSKWW
LTEFKTVKFPSQGTVFDYYIDQETKKFEPWGKLIPQFEFDPEMPLQACLVHTSETIRVCY
FMERLMERRRPVMLVGSAGSGKSVLVGAKLSSLNPEEYMVKNVPFNYYTTSAMLQAVLEK
PLEKKAGRNYGPPGNRKLIYFIDDMNMPEVDAYGTVQPHTVIRQHLDYGHWYDRNKLSLK
EIMNVQYISCMNPTAGSFTINPRLQRHFSVFALCFPGADALSSIYSTILTHHLKLGNFPT
TLQKSIPSLINLAVTFHQKIATTFLPTAIKFHYIFNLRDFANIFQGILFSSTECVKSTQD
LVKLYLHESDRVYRDKMVEEKDFNLFDKLQTEFLKKNFDDSKGMLEQTQNLNMYCHFANG
IGEPKYMPVQSWDLLSQTLVEALESHNEVNAVMDLVLFEDAIHHICHINRILESPRGNAL
LVGVGGSGKQSLTRLAAFISSMDVFQITLRKGYQIPDFKVDLASLCLKAGVKNLSTVFLM
TDAHVADERFLVLINDLLASGEIPDLYSEEEEENIINNVRNEVKSQGLIDSRENCWKFFI
ERVRRQLKVTLCFSPVGNKLRIRSRKFPAIVNCTAINWFHEWPQEALESVSLRFLQNTKN
IEPAVKQSISKFMAFVHISVNKISQSYLINEQRYNYTTPKSFLEFIRLYQSLLERNGKEL
QSKVERLENGLLKLHSTSAQVDDLKAKLATQEVELRQKNEDTDKLIQVVGVETSKVSREK
AIADEEEQKVALIMLEVQQKQKDCEEDLAKAEPALTAAQAALNTLNKTNLTELKSFGSPP
LAVSNVSAAVMVLMAPGGKVPKDRSWKAAKITMTKVDSFLDSLIHFDKENIHENCLKAIR
PYLQDPAFNPEFVATKSYAAAGLCSWVINIVRFYEVFCDVEPKRQALNKATSDLTAAQEK
LAAIKAKITHLNENLAKLTTKFEKATAEKLKCQQEAEVTAGTISLANRLVGGLASENVRW
AEAVQNFRQQERTLCGDILLTTAFISYLGFFTKKYRKSLMDGTWKPYLSQLKVPIPTTPT
LDPLKMLTDDADVATWQNEGLPADRMSMENATILINCERWPLMVDPQLQGIKWIKNKYGE
ELRVTQIGQKGCLQTIERALEAGDVVLIENLEESIDPVLGPLLGREVIKKGRFIKIGDKE
CEFNPKFRLILHTKLANPHYQPELQAQATLINFTVTRDGLEDQLLAAVVSMEIPDLEHLK
SDLTKQQNGFKITLKTLEDNLLSRLSSASGNFLGETALVENLEVTKQTAAEVQEKVQEAK
LTEVKINEAREHYRPAAARASLLYFIMNDLSKIHPMYQFSLKAFSIVFQKAVEKAAPSED
VKERVTNLIDSITFSVYQYTTRGLFECDKLTYLAQLTFQILLVNQEVNAAELDFLLRAPV
QAGTPSPMEFLSHQAWGSIKALSSMEEFCNLDRDIEGSAKSWKKFVESECPEKEKFPQDW
KNKTGLQRLCMMRAMRPDRMTYAMRDFVEEKLGSKYVMGRPLDFVSSFEESGPATPMFFI
LSPGVDPLKDVENQGKKLGYTFNNRNFHNVSLGQGQEVVAEAALDLAAKKGHWVILQNIH
LVAKWLSTLEKKLEELSEESHPDFRVFISAEPAPSPEGHIIPQGILENSIKITNEPPTGM
HANLHKALDNFTQDTLEMCSRETEFKTILFALCYFHAVVAERRKFGPQGWNRSYPFNTGD
LTISVNVLYNFLEANTKVPYDDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFIRPEMLEG
ELSLAPGFPLPGNMDYSGYHQYIDAELPPESPYLYGLHPNAEIGFLTQTSEKLFRTVLEM
QPRDSQAGDGAGSTREEKVKAFLEEILDRVTDEFNIPELMAKVEERTPYIVVALQECERM
NILTREIQRSLRELHLGLQGELTMTSEMENLQNALYLDVVPEPWARRAYPSTAGLAAWFL
DLLNRIKELETWTGDFVMPSTVWLTGFFNPQSFLTAIMQSMARKNEWPLDQMALQCDVTK
KNREEFRSPPREGAYIYGLFMEGACWDTQAGIIAEAKLKDLTPPMPVMFLKAIPAEKQDC
RSIYACPVYKTCQRGPTYVWTFNLKTKENPSKWVLAGVALLLQI
NT seq 13455 nt   +upstreamnt  +downstreamnt
atgccgggcgcggaggagcaggcagtgctggcggagtctggggacgaggaacctggagac
ccgaggctgcggctcctggggacttttgtggctcggagcctgcgtccggccgcgggcacc
tgggagcgttgcgcaggcacagccgaggcagggcggctgctgcaggccttcctggatcat
aatgccgccgcgggtccgtgcccgctgctggtggttcagtccgggcccgggggcctggta
gtgagacccggtctggatgcaggaccggagcccaaccaggctcgcgccaaggggcttttt
ttcttgcgcaccaggtccgagcctccgggaaatcacagccttcgcggcacggtgctctgc
ggggacctgcccgcggtgccgctggagcacctggctccgctgctttctgaggtcattatt
cctgtcctggacaatgaaaagaaccatctagactggccccacatggtatgtcaagacatc
aggcatcatgcccactccctgcagtctgatctcctggtaattcttgaacacatgaagggg
agaaccttgctacctcttccagttggctcagaaaaagtggagtttgtggatggccagagt
gagccggtcttggattccatagacaagtcaactgtctatgccatggagtctgcagtgatc
aaatggagccaccaagtccaggtggtactcaagagggagtcttctcagccactcatacaa
ggagaaaagcccacccccaaggtggagctggagttctggaagagcaggtgcgaggacctg
gaacacatttataaccaactaatgacaatcaaggtaaggggcatggctggactcctggac
aaacttcagagcagctacttgccagctttcaaagccatgttccaagacgttgaagcagcc
ctgacagaggcccaggacatccgtgtgcacctgttaccgctccaacaacacctggacatc
ctggagaacatggagtttcccgaggtgaagggcaggctgcggcctctgctccatgtggtc
tgtctgatttgggctaactgcaagtggtaccgctccccagggaggctcacggtgctgctc
caggaaatctgtaacctcctcatccagcaggcctctaattacctcagcccggaagacctc
ctgagaagtgaggtggaagagagtcagagaaaactgcaaatagtctcagataccttaagc
ttcttcaaacaggcatttcaggacagaagggaacatctccatacttacttcaaggaggac
tctgaagtcagggcatgggatttccaagcatctctggtctttgtacgactggatggcttt
ctgggccgactacgcatggtggaggatcttctgaagacagccttggatttcaacaagctg
gaaaagcttgaattcagtggcctcagaggaaactcactgagtcagaaagttcagcaaatg
catgaggaatttgaagagatgtacaaggtcttcctggactgttcctatgactgtttgaac
cccgagagcatggaatttgaaaatgatgtttgtggatttaacaagagagtggaagatctt
gaccgaagactcgggactatcttaattcaagcttttgatgatgtacctgaggtagagcac
gcctttaagctcctagatatcacagggacccttgtcgaaagacccctggtagcacaggat
gtgtcacacaaatacctggccctcatccgaatgttcaacacagaactggatgccgtgagg
atcatctacagtcagcacatccgggaagaggtggagcatggattctctcccgtgcacaaa
aatatgcccactatggctgggggcatccgctgggcacaggaactgaggcagcgcatcaag
ggtcccttcagcaacttcaaaaatataccacactggtgcttgcaatctgctgaaggaaag
agaatgatacaaaaatatgaagatttgctcaccctgctagaagagtatgagagaagactt
tatgaggactggtgtcagacagtgtctgagaagtcacagcgcaatctctccctaccactt
ttgcatcgtgaccccatcacaaagcagctctctgtcaactttaactcacagctgatttca
gtgttgaaagaaatgaactatcttcagcccactgaggtgaaaccgatccccgagaccgca
gcagccatgttctcctccagggaattctatcgccagcttgtggccaacttggagttgatg
gcaaattggtacaacaaggttataacaactctgctggaggtggaatttccactagtggag
gaagaactgcaaaatattgatctccgtctgagagctgcagaggagactctgagctggaaa
acagaaggcatttgggattatgccatgcaaataaccaatagcattcatgacctggaacga
agaattcagaagacaaaagacaacgtggaagagattcaaaccatcatgaaaacatgggtg
tctccaatatttaagagaaaggatgggaaaaaagaatgccccctttctctggatgatcag
caggatctcctggaaaaatactacagtctcatcagggaatcaggccttaagattcatgct
cttgttcaggaaaacctggttctatttgcagcagacccagcatccagtacctggaagtct
tacgtgggccacattgactcgatgttgttggatggattctttcttgccattgagtgttct
ctcaagtatctactagaaaacactgagtgtaagcctggactcactccaatatttgaagca
cagctcaaccttgtcaccccagaattagttttctacccctccctggactcaggggtaaag
ggaggcttatatgacattgtccagagtcttgtcaccagcatctttgctgtgccatccctg
gtgccccggctttccccacacagtggctctcctcactatcagggtgacctagaggaaatg
gctgacttagccagccttcggagcttgctcctggagagggtgcagactatgatgaccctc
tgctgtagctatcggaataccctcagccagtattcttatctgtatgtggaggataggaag
gaggcccttggccagtttctgctctatgggcatgtcctcacacctgaggagatagaagcc
catgtcgaagatggcatcccagagagtccgcccctcctccatcacttcaaagaccagata
gactcctatgaaaagctatatgaagatgtggtcagcctggaacccagcaaggtgtttgac
ggctggatgcgagtggatgtgagacccttcaaggcatctctgctgaacacaataaagaag
tggagcctcatgttcaagcaacatcttgttgactttgtcactaacagcctggctgacctt
gactcattcataaagagcactgagtgtggtttgctcaagagggtggaaaaaggagatttc
cagggattggttgagatcatgggacaccttgtcacccttaaagaacggcagagcagcacc
gatgacatgtttgagcccctgaagcaaacgattgaactgctgaagtcctacgaacaagag
ctgcctgaaactgtgtttaagcaactggaggaacttccggagaagtggaagaatgtgaag
aagatggccatcactgtgaggcagcaggtggcccctctacaggcaaatgaagtggccctc
ctccgccagcggtgctcagcctttgatgatgaacagcagcaattccaggagaggttccac
aaagaagctcccttcaggtttgatagtatcaatccacatcaaatgctagatgtctggcac
atggagatccagcacatggaatcgaccatggcaaccatctccaagtcagctgatttgttt
gaagtcaatgttcctgactacaagcagctgaggcagtgcagaaaggaggcctgtcagcta
aaggaactctgggacaccattggaatggtgacttccagtatccaagcctgggaggccacc
agctggaggaatatcagtgtggaagccatggactcagagtgcaagcagttcgcccggcaa
atccgcaacctagataaggagttcagaacctgggatgcattcacaggcctggaaagcaca
gtactgaacactctgacctccctgagggccgtggctgagctgcagaatcctgccatccgg
gaacggcactggaggcaactgatgcaggccacaggggtgaatttcaccatggatcgggac
accaccctagctcacctcctgcagcttcagctccaccactttgaggatgaggtccgggac
attgtggacagagcagtcaaagagatgagtatggagaagaccttaaaggaattgcagact
acctgggccagcatggagttccagtatgagacccatgcgcgaacccacatacccttgctg
cagtcagatgaggacctcattgaggtcctggaggacaatcaggtgcaacttcagaacctg
atgatgtccaagtatgttgctttcttcctggaagaagtgtcaagctggcagaagaagctg
tccacggctgactcggtcatctctatctggtttgaggtgcagcgtacctggtctcacctg
gagagcatattcattggctcggaagacatccgtgctcagctaccccaggacgctaagaga
tttgaaagcattgactctgacttcagagagctggtgtatgatgctcagaaaaccccaaat
gtggtcgaagccacaaataagtcaggtctctatgaaaaactggaagatattcagagcagg
ttgtgcctgtgtgagaaagcccttgcagagtacctagacaccaagagactcgccttccct
cgcttttacttcctgtcctcctctgacctgctagacatcctttccaatggcacagcccca
caacaggttcaacgtcacctttccaagctctttgacaacatggctaagatgcagttccag
ttagatgccagtcagaacccaaccaagacaagcctgggcatgtacagcaaagaggaggaa
tatgtggccttcagtgagccctgtgactgcagtggacaggttgaaatatggttaaaccgt
gtgcttcgtcacatgaaagccactgtgaggcatgagatgacagaggcggtcactgcctat
gaggaaaagcccagggatcagtggctgtttgattacccagctcaggtggctctgacctgc
actcagatctggtggacgacagaggtgggcattgcatttgccaggctggaagaaggctat
gagaatgccatgaaggactactataagaagcaagtggcccaactcaaaacccttatcacc
atgctaatcgggcagctctccaagggggacaggcagaagatcatgaccatatgcactatt
gatgtgcatgcccgggatgtggtagccaagatgattgctcaaaaggttgacaatgcccag
gctttcctctggctgtcacagctacgccatcgttgggatgatgaggccaagcactgcttt
gctaacatctgcgatgcccagtttctatattcctatgagtacctgggaaatacccctcgc
ctggtgatcacgcctttgactgataggtgctacatcactctcactcagtctctacacttg
accatgagtggggctccagccggacctgcaggcacaggcaagacagagaccaccaaggac
ctgggccgagcactgggcatcatggtctatgtgtttaactgttccgagcagatggactac
aagtcctgtggcaacatctacaaaggcctggctcagactggtgcctggggctgttttgat
gaatttaaccgaatctctgtggaggtcttgtcagtggtggctgtgcaggtgaaaagcatc
caggacgcaatcagagacaagaagcagaggttcagcttccttggggaggagattagcctt
gacccttctgtgggcatcttcatcactatgaacccgggctatgctggccgcacagaactg
ccagaaaacctcaaggccctcttcaggccctgtgcaatggtagttccagactttgagctg
atctgtgagattatgctggtagcagaaggattcattgaagcccgattgctggccaggaag
ttcattaccctttaccggctgtgtaaagaacttctctccaaacaggatcactatgactgg
ggacttcgggccatcaagtctgtccttgtggtagcaggatcactgaaacggggagaccct
gaccgaccagaggaccaagtcctgatgcgctccttgagagacttcaacatccccaagatt
gtgacggatgacatgccagtgttcatgggtctgatcagcgacctctttcctgctcttgac
gtcccccggaagagagatttggactttgaagctgtggttcggaaagcaattgtggacctt
aagctccaggctgaggacaactttgtgctcaaggtagtccagctggaggaactgctagcc
gtgaggcactctgtgttcatcgtgggtggtgctggtactgggaagtcacaggtactgaag
tctttacacaagacctatcagatcatgagatgtcgccctgtgtggactgaccttaacccc
aaagctgtcacaaatgacgaactctttggcatcatcaatccagccactcgagaatggaag
gacggactgttctcttccatcatgagagagcttgccaacatctcccatgatggccccaag
tggatcttactggatggtgatatagacccgatgtggatcgagtctctgaacaccgtcatg
gatgataacaaggtactgaccctagcaagcaacgagagaatcccccttaaccccacaatg
cgtctcctttttgagatcagtcacctgcgcacagccacaccagcaaccgtctccagagca
gggatcctgtacataaaccctgcagacctgggatggaaccctccagtaaacagctggata
gaccaaagagaggtccaaactgagagagccaacctgaccatcttgtttgacaaatacctt
cctacctgcttggacaccctcagaaccagatttaagaagataatcccagtcccagagcag
agcatgatccagatgctgtgctacctccttgagtgcctcctgacaaaggaggctgtccct
gcagactgccccaaggaaatctatgaactctattttgtgtttgctgccatctgggcattt
ggcagttccatggtccaagatcagcttgtagactaccgggcagagttcagcaaatggtgg
ctgactgagttcaaaacggtcaaatttccttcccaaggaactgtctttgactactacata
gaccaagagaccaagaaatttgagccttggggcaagctcatcccccagtttgaatttgac
cctgagatgcctttgcaagcttgtttggtacacacaagtgagaccatccgtgtgtgctac
ttcatggagcggctcatggaacggcggcggccggttatgctggtcggctctgcaggctca
ggcaagtctgtgctggtgggagcaaagctgtccagccttaaccctgaggaatacatggtg
aaaaatgtgcccttcaactactatactacatcagcaatgctgcaagctgtcctggagaaa
cctctagaaaagaaagctggaaggaattatggccctccaggtaacaggaaactcatctac
ttcatcgatgacatgaacatgcccgaggtggacgcctatgggacagtacagccccacact
gtcatcaggcagcacctagactatggccactggtatgatcggaacaaactgtctctgaag
gagatcatgaatgtacagtacatttcctgtatgaaccccactgcaggcagctttaccatc
aacccaagactccagcgccacttcagtgtgtttgccctctgcttcccaggagctgatgct
ctctcttccatctatagcaccatcctgacccatcacctgaagcttggaaacttccccacc
accctgcaaaaatccatcccttctctaatcaacctggctgtcaccttccaccagaaaatt
gccaccacatttctgcccacagcaatcaaatttcactacatcttcaacctcagagatttt
gccaatattttccaaggcattcttttctcctccactgaatgtgtgaagtccacacaggac
ctcgtaaaactctatctgcatgagtcagaccgggtttatcgggataagatggtggaggaa
aaggatttcaatctttttgacaaactccaaacagaattcctcaagaaaaattttgacgat
agcaaagggatgctggagcagacccaaaacctgaacatgtattgtcactttgcaaatggc
attggtgagcccaagtacatgcctgtgcaatcatgggaccttctgagccagactctggtg
gaagccctggagagccacaacgaagtgaatgctgtgatggacctggttctctttgaggat
gccatacatcatatctgtcacatcaaccgaatcctggagtcccctcgaggaaatgccctg
ctagttggtgtaggtggaagtggtaagcagagtctgaccaggctggcagcttttatcagt
tccatggatgtgtttcagatcactcttcgaaaaggctatcaaatccctgacttcaaggtg
gacctggccagcctctgtttgaaagctggggtaaaaaatctcagtaccgtgttcctgatg
actgatgcccatgtggctgatgagaggttcctggtgctcatcaatgatctcctggcatct
ggtgagatcccagatctctactctgaggaggaggaggagaacatcataaacaatgtcagg
aatgaggtcaaaagccagggactcattgacagcagagagaactgctggaagttcttcata
gagagagtccggagacaacttaaggtgactctctgtttctcccctgtggggaacaagctg
agaattcgaagcaggaagttcccagccattgtgaactgtactgctatcaactggttccac
gagtggcctcaggaggcactggagtctgtgagcctccgtttcttgcagaatacaaagaac
attgagcctgcagtgaagcaatcgattagcaagttcatggcctttgtccacataagtgtc
aacaagatatcccagtcatacctgatcaatgagcagcgctacaactacaccactcccaag
tcctttctggagttcatcagactataccagagcttgctggagaggaatggaaaagagctc
cagtccaaggtggaaaggctggagaatgggctgttaaagctgcacagcacctcagcccag
gtggatgatctgaaagccaagcttgccacccaggaagtggagctgagacagaagaatgaa
gatacagacaagctgattcaggtggtgggtgtggagaccagcaaagtgagcagagagaaa
gccattgcagacgaagaggagcagaaggtggcactgatcatgctggaggtgcagcagaaa
cagaaagactgtgaggaggacctggctaaagctgaaccagcccttaccgcagcccaggca
gccctcaacacactcaacaagaccaacctgacagagctgaagtcatttggttcgccacct
ctggctgtcagcaatgtcagtgcagcagtgatggtcctcatggccccaggggggaaggtg
cccaaggaccgcagctggaaggctgccaagatcaccatgaccaaggtggacagcttcctg
gattccctaatccacttcgacaaggagaacattcatgagaattgcctcaaagccatcagg
ccatacctgcaagatcctgctttcaacccagagtttgtggccaccaagtcctacgcagcc
gcaggcctctgctcttgggtcataaacattgtgaggttctacgaggtcttctgtgatgtg
gaaccaaagcgccaagctttgaacaaagccacctcagacctcacagctgcccaggagaag
ctggcagccatcaaagccaagatcacccaccttaatgaaaacctggcaaagctcaccacc
aagtttgagaaagcaacagcagagaaactcaagtgtcagcaagaagcagaagtgactgcg
ggcaccatttcccttgcaaaccgtctggttggaggacttgcttctgaaaacgtacggtgg
gcagaggccgtgcagaacttcagacagcaggaaaggacattatgtggtgacattctgctt
actacagccttcatttcctacttgggcttctttaccaaaaagtaccgaaagagcctcatg
gatgggacctggaaaccctatctgagccaactgaaagttcccattccaaccaccccaacc
ctggaccccctgaagatgctaactgatgatgctgatgtggctacctggcagaatgagggt
ctccctgctgaccgaatgtccatggagaatgccaccatcctcatcaactgtgagcgctgg
ccactcatggtcgaccctcaactgcaaggcatcaaatggatcaagaacaaatatggggaa
gaactccgtgtcacacagatcggccaaaaaggctgccttcagaccatagagcgtgctctg
gaagctggagatgtggtgctaattgagaaccttgaggagtccattgatcctgtcctggga
cctttgcttgggagagaagtcattaagaaaggacggttcattaagattggagacaaggaa
tgtgaattcaatcccaagttccggctcatccttcacaccaagctggccaaccctcactac
cagcctgagctgcaggctcaggccaccctgatcaacttcacagtgaccagggatggcctg
gaagaccagctgctagctgctgtagtcagcatggagataccagacctggagcatctgaag
tcagatctcactaagcagcagaacggtttcaaaatcaccctcaaaaccttagaggacaac
ctgctgtctcgcctctcttcagcctcagggaacttcctgggagaaacagccttggtggag
aacctggaggtcaccaagcagacagctgcagaggtgcaggaaaaggtccaggaagccaaa
ttgacggaagtaaaaatcaatgaggcccgagagcactataggccagcagctgcccgggca
tctctgctctacttcatcatgaatgacctcagcaagatccatccgatgtatcagttctcc
ctcaaggccttcagcattgtcttccagaaagctgtggagaaggcagctcccagtgaagat
gtcaaagagcgagtcactaatctaatagacagtataactttctcagtgtaccagtacacc
acgcgtggcctcttcgaatgtgataagctgacctacctagcccagctcacctttcagatt
ctcctcgtgaaccaggaagtcaatgcagcagagttggacttcttgcttcgggctccagta
caggcaggaactcccagcccaatggagttcctgtcccaccaggcctggggaagcatcaag
gcactctcatccatggaggaattctgcaatctggatcgagacattgaaggctctgccaag
agctggaagaagtttgtggagtcagagtgtcccgagaaggagaagtttccccaggattgg
aagaacaagacaggccttcagcgcctctgcatgatgagagccatgagacctgaccggatg
acctatgccatgagagattttgttgaggagaagttaggaagcaaatacgtgatgggaaga
ccactggattttgtaagctcatttgaagagtcaggaccagccactcccatgtttttcatc
ctgtctccaggggtggacccactgaaggatgtggaaaatcaaggaaagaaactcggatat
acattcaacaatcggaacttccacaacgtgtctctagggcaaggtcaagaagtagttgct
gaggctgcactggacctggctgctaagaaaggtcactgggtgattctgcagaacatccac
ctggtggccaaatggctcagtaccctggagaagaaactggaggagctcagcgaggaaagt
cacccagacttcagggtcttcatcagcgccgagcctgcaccctcccctgagggccacatc
attccccagggcattctggaaaactccattaagatcaccaacgagccccccacaggcatg
catgccaacttacacaaagccctggacaatttcactcaggacactctggagatgtgctcc
cgggagacagagttcaagaccatcctctttgctttgtgttactttcatgccgtggttgcc
gaaagacgcaagtttgggccgcagggatggaatcgttcctacccctttaacactggggac
ctcaccatctctgtgaatgtgctgtacaatttcctggaggctaacacaaaggtaccctat
gatgacttgcgttacctgtttggtgagatcatgtacggtggccatatcacagatgactgg
gacaggagactctgcagaacctatttagaggaattcattaggccagaaatgctggaagga
gagctgtccctggccccagggttcccactcccaggcaacatggactacagtggctatcat
cagtatattgatgctgagctgccccctgagtctccctacctctacggcctccacccaaac
gcagagatcggcttcctgacccagacatcggaaaagctcttccgaaccgtgctggagatg
caacctcgggacagccaggccggagatggagctggcagcacaagggaagaaaaggtcaaa
gcctttctggaagaaatactggatcgggtgacagatgaatttaacatcccagagctaatg
gctaaggtggaggaacgcaccccctacattgtagttgccctccaggagtgtgaacgcatg
aacatcctgaccagagagatccagcgctcgctaagagagctgcatcttggtttacagggg
gagctgaccatgaccagcgagatggagaacttacagaatgccctatacctagatgtggtc
ccagagccctgggccaggagagcctacccttccacagcaggccttgcagcctggtttctg
gacctgcttaacagaatcaaagagctagagacctggacaggggacttcgtgatgccctca
actgtgtggctgacgggcttcttcaacccccagtccttcctgactgccattatgcagtcc
atggctcgcaagaatgaatggccactagaccagatggccctgcaatgtgatgtgacaaag
aagaacagagaggagttccggagccctcctcgggaaggggcctacatctatgggctcttc
atggaaggcgcctgctgggacacacaggctgggatcattgcggaggcgaaactgaaggac
ctgacaccccccatgcctgtgatgttcctcaaggccattccggcagagaagcaagattgc
cgaagcatctatgcttgtcctgtgtacaagacttgtcaacggggacccacgtacgtgtgg
acttttaatctgaagactaaagaaaacccttccaagtgggttctggctggtgttgccttg
cttctccagatttag

KEGG   Rattus norvegicus (rat): 117252
Entry
117252            CDS       T01003                                 

Gene name
Dnah10
Definition
(RefSeq) dynein heavy chain 10, axonemal isoform X1
  KO
K10408  dynein heavy chain, axonemal
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    117252 (Dnah10)
   05016 Huntington disease
    117252 (Dnah10)
   05022 Pathways of neurodegeneration - multiple diseases
    117252 (Dnah10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    117252 (Dnah10)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     117252 (Dnah10)
SSDB
Motif
Pfam: AAA_6 DHC_N1 DHC_N2 AAA_8 Dynein_C AAA_9 AAA_7 MT AAA_lid_11 Dynein_heavy AAA_5 AAA_lid_1 Dynein_AAA_lid AAA_22 AAA RsgA_GTPase AAA_18 Spo7_2_N FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 117252
NCBI-ProteinID: XP_008767494
RGD: 619988
Position
12
AA seq 4592 aa
MDDLRVLWMRDRIYTAFNITDPMPFEELLSRDDSEAEDLILHFLNHSSDEDNASAVFFYR
TLVPEEVEVEEIEDIPTTFEEEGEEEESEYQKVEVTDKTAVKPSKPKNDSLTPPLFDMED
DEPDIENYSKPYNKRLVKRIINRLELHVSLTPLSEEFLEQNVVFFLRSSKDAIPEASDMK
EAMEIMPETMEYGIINSQVLQFLKDIICQVFMPALSFNQHKSESGQVASPPEVQEFSSYD
ITDLPSMLGETMEYHSIQLIRDEFLMNLQKFANNIQRTMQQLEGEIKLEMPSISVEGEVS
ELVADPELVETLEQCVINWLGQISYAVDSQLKKKPQGNGPLAEIEFWRERNATLSALYEQ
TKLPFVRKVLEVIKEAESMLTANVQPVLTELFKLHMEASDNVRFLSTVERHFKNITHGSN
FHVVLDTIPSMMSALRMVWIISRHYNRDERMIPLMERIAWEIAERVCRVINLRTLFKENR
ANAQFKTQEAKNTLKLWKKSYFDIRAKIEASGREARWEFDRKRLFERTDYMANICQDLSD
ILRVLEEFYNIFGPELKAVTGDPKRIDDVLCRVDSLVAPMETLNFDPFNIRSAPYWKYVM
EDFKLEVLVIEKEAKNFIDESFKTLRSAEAAFDMLLKFKHIRSREAINRQMMMKFNDILA
QYYKEIDIVNKIFEQNLDNPPLYKNHPPVAGAICWERSLFYRIKHTILRFMEVEELLDSE
RGQEVKQRYLEVGRKMKEYEDVKYEHWKETTEQSLPNLMKKSLLTKNTITSEDSAVIDRG
TMFVINFSPVLREIINETKYLEQLGFTVPELARNVALQEDKFLRYTEGIQRMLDHYHLLV
NTLNEAESVLLDDHSQELLRVFRSGYKRLNWNSLGIADYITRCKQAIGKFESLVHQIHKN
AEDINSRLTLIESINLFRSPVIKTEDKLPGVKEFFEYIERERSRDVDHMVRWYMAIGPLL
TKVEGLVVHTNTGRAPKLASYYEYWEGKIYDVLVKLILKNLQAFNSLILRNVPLFQAETI
LSAPEIILHPNANEIDKMCVHCIRGCVEVTKYFVRWMNGSCIECPPQKGEEEEIVIISFY
NDISQNSQIMDQAVMIPQNIHRLLVNIMKYLQRWKRYRPLWKLDKSIVMEKFAAKKPPCV
AYDEKLQFYAKIAADVMRHPLVKDEHCIRLQLEPLANTVQENAKSWVTSLGKLLNESARE
ELYSLRDEIEHLAKNLKKSPNTLDDLKFVLATISEIRTKSLIMELRYKDVQERYRTMAIY
SIFPPEAEQELVDNIENMWETLFTDSVNVEHALGGIKRTFTEITRSEIINYRSQVDEFAK
RFYSEGPGAVGEDLDKGSELLGSFEKELARHEKNRQELANAEKLFDLPITMYPELMKVQK
EMAGLRMIYDLYDSLKIAKEEWSQTLWINLNVQYLQEGIEGFLKNLRKLPRHVRSLSVAF
HLETKMKAFKDSIPLLLDLKHEALRERHWKELMEKTGVFFEMTETFTLDNMFAMELHKHT
EVLNEIVTAAVKEVAIEKAVKEILDTWENMKFTVVKYYKGTQERGYILGSVDDIIQCLDD
NTVNLQSISGSRFVGPFLQTVHKWEKTLSLIGEVIEIWMLVQRKWMYLESIFIGGDIRSQ
LPEEAKKFDVIDRIFKRIMGDTLKDPVIKRCCEAPNRLHDLQTVSEGLEKCQKSLNDYLD
SKRNAFPRFFFISDDELLSILGNSDPLCVQEHMIKMYDNIAMLRFHDGDSGEKLVSAMIS
AEGEVMVFRKIVRAEGRVEDWMTTVLNEMRRTNRLITKEAIFRYCEDRSRVDWMMMYQGM
VVLAASQVWWTWEVEDVFNKVKQGDKQAMKNYGKKMHRQIDDLVTRITMQLSKNDRKKYN
TVLIIDVHARDIVDSFIRGSILEAREFEWESQLRFYWDREPDELNIRQCTGTFGYGYEYM
GLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCG
EGMDYKAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALIHQLTTFQFEG
QEISLDSRMGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLGAK
TLAKKMTVLYKLAREQLSKQHHYDFGLRALKSVLVMAGELKRGSADLQEDVVLMRALRDM
NLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPDFNDAVEDVLEENGYVLLPVQVDKVVQM
FETMLTRHTTMVVGPTGGGKSVVINTLCQAQTKLGILTKLYILNPKAVSVIELYGILDPT
TRDWTDGVLSNIFREINKPTDKKERKYILFDGDVDALWVENMNSVMDDNKLLTLANGERI
RLQSHCALLFEVGDLQYASPATVSRCGMVYVDPKNLKYQPYWKKWLQQIQNKVEQKYLND
LFEKYVPILIDLIIEGILDGRQGEKLKMVVPQTDLNMVTQLTKMMDSLLEGEIEDPDLLE
CFFLEALYCSLGSSLLEEGRIKFDECIKNLSSMPTAETEGNWARPGELPGHLPTLYEFHF
DSKRNYWIPWNKLVPEYVHNHQKRFVDILVHTVDTTRTTWILEQMVKIKHPVLFVGESGT
SKTATTQNFLKNLNEETNIVLMVNFSSRTTSLDIQRNLEANVEKRTKDTYGPPMGKRLLV
FMDDMNMPKVDEYGTQQPIALLKLLLEKGYLYDRGKELNCKSIRDLGFIAAMGKAGGGRN
EVDPRFLSLFSVFNVPFPSEESLHLIYYSILKGHTSTFAESISGVSRKLTFCTLTLYKNI
VQDLPPTPSKFHYIFNLRDLSRVFNGLVLTNPDRFQTVSQMVRVWRNECLRVFHDRLINE
VDKQLVQDYIGNLVKEHFNDDYEMVMRDPILFGDFRTALQEEEPRIYEDIQDYEAAKALF
EEILEEYNEVNTKMNLVLFDDALEHLTRVHRIIRMDRGHALLVGVGGSGKQSLARLAAFT
AGYEVFEILLSRGYSENNFRDDLKNLYMKLGLENKLMIFLFTDAHVAEEGFLELINNMLT
SGMVPALFTEEEKDNILSQIGQEALKHGMGPAKESVWQFFVNKSANNLHIVLGMSPVGDT
LRTRCRNFPGLVNNTGIDWFMPWPPQALHAVAKSFLGNNSMIPSEKLEDLVEHVVLVHQS
VGEFSKQFQQKLRRSNYVTPKNYLDFINTYSKLLDEKTQYNIAQCKRLEGGLDKLKEATI
QLDELNQKLAEQKIVLAEKSAACETLLEEIATNTAIAEEKKKLAEEKAIEIEEQNKIIAV
EKAEAETALAEVMPILEAAKLELQKLDKSDVTEIRSFAKPPKQVQTVCECILIMKGYKEL
NWKTAKGMMSDPNFLRSLMELDFDSITQGQVKNIKGLLKTLNTTIEEMEAVSKAGLGMLK
FVEAVMGYCDVFREIKPKRDKVARLERNFFLTKRELERIQNELAAIQKELEALGAKYEAA
ILEKQKLQEEAEIMERRLIAADKLISGLGSENVRWLNDLDELMHRRVKLLGDCLLCAAFL
SYEGAFTWEFRDAMVNQEWRNDILDRDIPLSQPFRLENLLTDDVEISRWGSQGLPPDELS
VQNGILTTRASRFPLCIDPQQQALNWIKRKEERNNLRVASFNDPDFLKQLEMSIKYGTPF
LFHDVDEYIDPVIDNVLEKNIKISQGRQFIILGDKEVDYDSNFRLYLNTKLANPRYSPSV
FGKAMVINYTVTLKGLEDQLLSVLVAYERRELEEQREHLIQETSENKNLLKDLEDSLLRE
LATSTGNMLDNVELVQTLEETKSKATEVSEKLKLAEKTALDIDRLRDGYRPAARRGAILF
FVLSEMALVNSMYQYSLIAFLEVFGLSLKKSLPDSILLKRLKNIMDTLTFNIYNYGCTGL
FEKHKLLFSFNMTIKIEQAEGRVPQDELDFFLKGNISLEKSKWKKPCTWLSDQGWEDIIL
LSEKFSDIFGNLPFDIEHNLPTWQEWYDKDSLEQFPFPLRYDDHITAFQKLLILRCFRVD
RVYRAVTDYVTLTMGEKYVQPPMISFEAIFEQSTPNSPIVFILSPGSDPASDLMKLAERS
GFGGTRLKFLAMGQGQEKVALQLLETAVARGQWLMLQNCHLLVKWLKDLEKSLERITKPH
PDFRLWLTTDPTKGFPIGILQKSLKVVTEPPNGLKLNMRATYFKISHDMLEQCPHTAFKP
LVYVLAFFHAVVQERRKFGKIGWNVYYDFNESDFQVCMEILNTYLTKAFQQHDPRIPWGS
LKYLIGEVMYGGRAIDSFDRRILTTYMDEYLGDFIFDTFQPFHFFRNKDVDYKIPVGDVK
DKFVEAIEALPLANTPEVFGLHSNAEIGYYTQAARDMWGHLLELQPQTGESSSGVSRDDY
IGQVAKDIENKMPKIFDLDQVRKHLGLNISPTSVVLLQELGRFNKLVIRMTRSLAELQRA
LAGEVGMSNELDDVARSLFLGHIPHIWRKLAPDTLKTLGNWMVYFLRRFNQYTLWVTESE
PSVMWLSGLHIPESYLTALVQATCRRNGWPLDRSTLFTQVTKFQDADEVNERAGQGCFVS
GLYLEGADWDIERGCLVKSKPKVLVVDLPILKIIPIEGHRLKLQNTFRTPVYTTSMRRNA
MGVGLVFEADLFTAKHISHWVLQGVCLTLNSD
NT seq 13779 nt   +upstreamnt  +downstreamnt
atggacgacctacgggtcctgtggatgcgcgaccgcatatacacggccttcaatatcacc
gaccctatgccgttcgaggagctgctgagccgtgatgacagcgaggcagaggacctcatc
ctgcacttcctcaaccactcaagcgacgaggacaacgcctccgcggtgttcttctaccgc
accctggtgcctgaggaggtggaggtggaggagatagaagacatccccacgacctttgaa
gaggagggagaggaagaggagagtgaatatcaaaaagtagaggtcaccgataaaacggca
gtcaagccctcaaagccgaaaaacgactccttgactccccccctgtttgatatggaagat
gatgaaccagacatagagaactacagcaaaccatacaacaagagacttgtaaaacgcatc
atcaacagactggaattgcatgtgagcctcaccccactttccgaggagtttctggaacag
aatgtggttttcttcctcagaagctcaaaagatgcaatcccagaagccagtgatatgaag
gaagcaatggaaatcatgccagagaccatggagtatggcatcataaactctcaagtgctc
cagttcctaaaggatatcatctgccaggttttcatgcccgcgctgtccttcaaccaacac
aaatcagagtcaggacaggtagcatcgcctccggaagtgcaggagttctcttcttatgat
ataacggacttgcctagcatgctgggggagacaatggagtaccacagcatccaactgatt
cgtgacgagttcttaatgaaccttcagaaatttgccaacaacattcaaaggaccatgcaa
cagctagaaggtgagatcaagctggagatgcccagcatcagtgtggagggagaagtgtcc
gagctggtggctgacccggaattggtggagactttggagcagtgtgtgatcaactggctg
gggcagatctcatatgctgtggactctcagctgaagaagaagccccagggcaatggtcct
ctggctgaaatcgagttctggcgagaaagaaatgcaacgttgagcgccctctatgagcag
acgaagctgccattcgtaaggaaagtcctggaggtgatcaaagaggcggagtccatgctc
acagccaacgtgcagcctgtcctgacagagctgttcaaactccacatggaggcctcggac
aacgtgcgcttcctatccaccgtggagcgtcacttcaagaacatcacccacggctccaac
ttccacgtggtcctggacaccattccatccatgatgagtgccctgcgcatggtctggatc
atatctagacactacaacagagacgagaggatgattccgctcatggagcgaattgcctgg
gagattgctgagcgtgtgtgccgagtcatcaacctacgcactctgttcaaggaaaacaga
gctaacgcccagttcaaaacccaggaggccaaaaacacactcaagctatggaagaaatcc
tacttcgatatccgggccaagattgaggcttccggtcgggaggcacgatgggaatttgac
cggaagcggctgtttgagagaacagactatatggccaacatctgccaggacctctcagat
attctacgggtcttggaagaattttacaacatatttggcccagagctcaaggctgtgaca
ggggaccccaagagaatcgacgatgtcctttgcagggtagacagcttggtcgcccctatg
gagactctgaactttgaccccttcaacatcaggtccgccccatactggaaatacgtgatg
gaagacttcaagcttgaagttctggttattgagaaagaagcaaaaaatttcattgacgaa
tctttcaagacacttcgctcggcggaagcggccttcgacatgctgctaaaattcaaacat
atccgatcccgggaagccatcaaccggcagatgatgatgaagtttaacgacatcctggca
cagtactataaggagattgatatcgttaataagatctttgagcagaacctggacaaccct
ccgctctacaagaaccaccctcccgtggcaggcgccatatgctgggagcggtccctcttc
tacaggatcaagcacaccatccttcggttcatggaggtcgaggaactcctggacagtgag
aggggccaggaggtgaagcagaggtacctggaggtggggaggaagatgaaggagtatgaa
gatgtgaagtacgaacattggaaagagaccacagagcagagcctcccgaacctcatgaag
aagagcctactcaccaagaataccatcacatctgaggactcggctgtcatagacagggga
accatgtttgtcatcaacttctctcccgttctcagagagattattaacgaaaccaagtac
ttagagcagctgggattcactgtccctgaactggcgaggaatgtggccctccaagaagac
aaattcctcaggtacacagagggaatccagcgcatgctggaccactaccacctgctggtc
aacacgctgaacgaggcagagagcgtgcttctggatgaccactcccaggagctgctccgg
gtgttccggtctgggtacaagaggctgaactggaactcactaggaattgccgactacatt
actcgctgcaaacaggccattggcaagttcgagtcactcgtccaccagatccacaaaaac
gctgaggacatcaactccaggctaacgctgatcgagtccatcaacctctttaggtcccca
gtcatcaaaacggaggacaaactcccaggtgtaaaagagttcttcgagtacatcgaacga
gaaaggagcagggatgtggatcacatggtccggtggtacatggctatcgggcctctgctg
accaaggtagaaggcctggtcgtacacaccaacacaggcagggcccccaagctggcctcc
tactatgagtactgggaaggcaagatctatgatgtcttggtgaagctcatcctcaagaat
ctacaggccttcaactctctgatcctcagaaatgtccctctgttccaagcggaaaccatt
ttgtcggctccagaaatcatcctccacccaaatgccaacgagatcgataagatgtgtgtt
cactgcatccgtggctgtgtggaagtcaccaagtatttcgtgcgctggatgaacggcagc
tgcatcgaatgtcccccacagaagggggaggaggaagaaattgtcatcataagcttctat
aatgacatctctcagaactcccagatcatggatcaagccgttatgatcccccaaaacatc
cacaggctcctggtgaacataatgaagtaccttcagaggtggaagcggtaccggcccctc
tggaagctggacaagtccatcgtgatggagaagtttgcagccaagaaaccgccctgcgtg
gcctacgatgagaagctgcaattctacgccaagatcgccgccgacgtgatgcgccaccca
ctggtcaaggatgagcactgcatccggctgcagcttgagccactggccaacaccgtgcaa
gaaaacgcaaagtcctgggtgacttcactcgggaagctcctcaacgagtcagctagggag
gaactttatagcctccgggatgagattgagcatctggccaagaatctgaagaagagcccc
aacacccttgacgacctcaagtttgtccttgcaacaatttcagagatcaggaccaaatct
ttaatcatggagctgaggtacaaggacgtccaggaacggtaccgcaccatggcgatatac
agcatctttcctccagaagccgagcaagaactggttgacaacatcgagaacatgtgggaa
actctcttcactgactctgtgaacgtagagcacgcacttggaggcatcaagcgaactttc
acagagatcacccggagtgagataataaactacagaagccaggtggatgagttcgcaaag
cgcttctacagtgagggccctggagctgtgggcgaagaccttgataaaggctcggaactc
ctaggcagttttgaaaaggagctggccaggcacgagaagaaccgtcaggaactggccaat
gcagagaagcttttcgacctacccatcaccatgtatcctgaactcatgaaagtgcagaag
gaaatggctgggctccggatgatctatgatctgtatgactcgctgaagattgccaaagag
gaatggtcccagaccctctggatcaacctgaatgtccagtatctgcaggaaggcatcgag
ggcttcctcaaaaacctccgaaagctgcctcggcacgtgcgcagcttgtccgtggccttc
catttggaaacgaagatgaaggccttcaaagactctatccccttgcttctggacctgaag
catgaggctctgagagagagacactggaaagaactcatggagaaaacaggcgtgttcttt
gagatgacagagaccttcacgctggacaacatgttcgccatggaacttcacaaacacacg
gaagtgctcaacgagattgtcactgcagccgtcaaggaggtcgctatcgagaaggccgtg
aaggagatcctagatacctgggagaacatgaagttcaccgtggtcaagtactacaaaggc
acgcaggagcgaggctacatcttagggtccgtggatgacattatccaatgcctggatgac
aacaccgtcaacttgcagagcatctcggggagcagattcgtggggccttttctgcaaacc
gtccacaagtgggagaagacactgtctctgataggcgaggtcattgagatctggatgctg
gttcagaggaagtggatgtacctggagagcatcttcattggtggggacataaggtcccag
ctgccagaggaggccaagaagtttgacgtcatcgacaggatatttaagaggatcatgggg
gatacactgaaagacccagtgataaagcgatgctgtgaggccccaaaccgcctccatgac
ctgcagactgtcagtgaaggcctagagaagtgccagaagagcttgaacgactacctggac
tccaagaggaatgccttccccagattcttcttcatctcagatgacgagctgctcagtatc
ttgggcaacagtgacccactgtgtgtgcaagagcatatgatcaagatgtatgacaacata
gccatgttacgcttccatgacggagacagcggggagaagctcgtgtcggctatgatctct
gcagagggagaagtcatggtcttccgaaagatcgtccgggccgagggtcgcgtggaagac
tggatgaccaccgtgctgaacgaaatgaggaggaccaacaggctcatcaccaaggaagcc
atcttcagatactgtgaagacagaagcagggtggactggatgatgatgtaccaaggcatg
gtggtgctggccgccagccaggtgtggtggacttgggaggtggaggacgtcttcaacaag
gtcaagcaaggggacaaacaggccatgaagaactacggcaagaagatgcacagacagatt
gatgatctggtcacacggatcaccatgcagctgagcaaaaatgacaggaagaaatacaac
accgtcctgatcatcgatgtacacgcccgggacatcgtggactccttcatccggggcagc
atcctcgaggcccgggagtttgagtgggagagccaactgcgcttttactgggaccgcgag
ccggacgagctgaacatccgacagtgcacggggaccttcggctatggctacgagtacatg
ggcctgaacgggaggctggtcatcacgccccttacggaccgcatctacctgacgcttacg
caggcgctgtccatgtatctgggaggtgcccctgctggcccggcgggaactggcaagaca
gagaccaccaaggacctcgccaaagccctgggcctcctgtgcgttgtcaccaactgtggt
gaaggcatggattacaaagctgtcgggaagatcttctctggcctcgcccagtgtggcgcg
tggggctgcttcgatgagttcaaccggatcgatgcttctgtgctgtctgtcatctcgtct
cagatccagacgattcgcaatgcgctgatccaccagctgaccacattccagttcgaaggg
caggagatctcccttgactctcggatgggcatcttcatcaccatgaaccctggctatgcg
ggccgcacagagctgcccgagtctgtgaaggcgctgttcaggcccgtggttgtcattgtt
cctgacctgcagcagatctgtgagatcatgctcttctctgagggcttcctgggggccaag
acgctggccaagaagatgaccgtcctctacaagctggcccgggagcagctgtcgaagcag
caccattatgactttgggctccgggccctgaagtcagtgctagtcatggccggtgagctg
aagagaggctcggcagacctgcaggaggatgtggtcttgatgcgggcactgcgtgacatg
aacctgcccaagtttgtatttgaggacgtccccctcttcctgggcctcatctctgatctg
tttcccgggctagactgcccccgtgtgcgctacccagatttcaacgatgccgtagaagat
gtgttggaggagaacggttatgtgctgctgcctgtccaggtagacaaagtggtccaaatg
ttcgagaccatgctgacccgccacaccacaatggtggtagggcccacaggagggggcaag
tccgtggtcatcaatactctatgtcaggcccagaccaagcttgggatcttgacaaaactg
tacatcctgaaccccaaagccgtgagtgtcattgagctgtatggcatcctggaccccacc
actcgagactggacagatggggtgctgtccaacatcttccgggagatcaacaagccgact
gacaagaaggaacggaagtatatcttgttcgatggcgacgtggatgccttgtgggtggaa
aacatgaactcagtgatggacgacaacaagctgttgaccttggccaacggggagcgcatt
cgtctccagtcccactgtgctctgctctttgaggttggagacttgcaatacgcatccccg
gccactgtgtctcgatgcgggatggtctatgtggaccctaagaacttgaaataccaacca
tactggaaaaaatggctacaacaaatacaaaacaaggtagagcaaaagtatttaaatgac
ctcttcgagaagtatgtgccaattctcatcgacttgatcatcgaagggattttagatggg
aggcaaggggagaagctgaagatggtggtccctcagacagacctaaatatggtgacccag
ttaaccaagatgatggactcgctactagaaggagaaattgaggaccctgacctgctagag
tgcttcttcctggaggctctctactgttcgctgggctcctccctccttgaggaaggaagg
atcaaatttgacgagtgtattaaaaacctctcctcaatgcccactgcggagactgaagga
aactgggcccgtcctggagaattgccagggcatcttcccaccctgtatgagtttcatttt
gattccaagcggaactattggatcccatggaacaagctagttcctgagtacgttcacaac
caccagaagagatttgtcgacatcctggttcacaccgtggataccacccgcaccacttgg
atactagaacagatggttaaaatcaagcaccctgttctttttgtgggcgaatccggcacg
tccaagacagccactacccagaacttcctcaaaaatctgaacgaggagaccaatattgta
ctgatggtcaatttctcctctcggaccacatccctggacatccagagaaatctagaagcc
aacgtagagaagaggacgaaggacacgtatgggccgcccatggggaagcgcctgctggtg
ttcatggatgacatgaacatgccaaaggtggatgagtatggaacccagcagcccatcgct
ctgctgaagctgctgctggaaaagggctacttatatgaccgtgggaaagaactcaattgt
aagagtatccgtgatctgggcttcatcgctgccatgggcaaggcaggagggggccgcaac
gaggtggaccccaggttcctgtcattgttcagcgtcttcaatgtccctttcccgtcggag
gagtccctgcacttgatctactactccattctgaagggccacacctcgacatttgcagag
agcattagtggcgtgagcaggaagctgacattctgcacgttaacgctttacaaaaacatc
gttcaggatctacctcccaccccttcgaagttccattacatcttcaaccttcgagacctc
tccagggtttttaatggccttgtccttactaatccagatcggttccagacagtgtcccaa
atggtaagggtgtggagaaacgagtgcttgcgcgttttccatgaccggctcatcaacgaa
gtcgacaagcagctggtgcaagactacatagggaacctggtgaaggagcattttaacgat
gactacgagatggtgatgagggatcccatcctcttcggggacttccggacggctctgcaa
gaggaggagccacgtatttatgaagacatccaggactacgaggccgccaaggcactgttt
gaggaaatcctcgaggagtacaacgaagtcaacaccaagatgaacctggtgctgtttgac
gacgcgctggaacacctgacgcgcgtgcaccgcatcattcgaatggaccgaggccacgcc
ttgctggtgggtgtgggtggctccgggaagcagtcgctggcgagactggcggccttcacc
gcaggctacgaggtgtttgagatcctgctgagccgaggctactccgagaacaacttccgg
gatgacctgaagaacctatacatgaagctggggctggagaacaagttgatgatcttcctg
ttcacagacgcgcatgtggctgaggagggcttcctggaactcatcaacaacatgctgacc
tcaggaatggtccctgcactgttcactgaagaggaaaaggacaacatcctcagtcagatt
gggcaggaggccttgaagcacggcatgggtccagccaaggagtccgtgtggcagtttttc
gtgaataaaagtgccaacaacttgcacattgtcctgggcatgtcgccagtgggagacacc
ttgaggacccggtgtaggaatttcccaggcctagtgaacaacaccggcattgactggttc
atgccctggccaccgcaggccttgcacgctgttgccaagtcctttttggggaataactcc
atgattcccagtgagaaactggaagacctcgtggagcacgtggttttggtccaccagtca
gtgggtgagttcagcaagcagttccagcagaagctgaggcgcagcaactatgtgacccct
aagaactacctggacttcatcaacacctactccaagctgctagatgagaaaacccagtac
aacattgcacagtgcaagcgtctggagggtgggctggacaagctaaaggaggccaccatc
cagctggacgagctgaaccagaagttggcagagcagaagattgtcctggccgagaagtcg
gctgcctgtgagaccctgctggaggaaattgccaccaacacagccatagctgaggagaag
aagaagctggcagaggagaaggccatagagattgaagagcagaacaagatcatcgctgta
gagaaggccgaggccgagacggcgctggctgaggtcatgcccatcctggaggccgccaaa
ctggagctgcagaaactggacaagtcagacgtgactgaaatcaggtcattcgcgaagcct
ccaaagcaagtgcagacggtctgcgagtgcattctcatcatgaaaggctacaaggagctc
aactggaaaactgccaagggcatgatgtccgaccccaacttcctgcggtccctgatggag
ctcgactttgactctatcacccagggtcaagtaaagaacatcaaaggcctcctgaagact
cttaacaccacaatcgaagagatggaggccgtgagcaaggcagggctggggatgctgaag
ttcgtggaggccgtcatgggctactgcgatgtgtttcgggagatcaagcccaaaagagac
aaggtggccaggctggagcggaatttctttctaaccaaacgggagctagagaggatccag
aacgagctggcggcaatccaaaaggaactggaggctttgggagccaagtatgaggccgcc
atcttggagaaacagaagctgcaggaggaggcagagatcatggagaggcggctgatcgca
gcggacaaactcatttctggtctgggctcagaaaatgtcaggtggctgaacgacctggat
gagctaatgcaccggcgggtgaagctgctaggtgattgcttgctctgtgcagccttcttg
agctatgagggcgccttcacctgggagtttcgtgatgcgatggtcaaccaggagtggagg
aacgacatcttggatcgagacattcccctgagtcagcctttccgactggagaacctcctc
acagatgatgttgagatcagcaggtggggctcccagggccttccccctgatgagctctcg
gttcagaacggcatccttacaacccgggccagtcgcttcccgctctgcatcgacccccag
cagcaggccctcaactggatcaaaagaaaggaggagaggaacaatctacgggttgcttcc
ttcaatgaccccgacttcctcaagcagctagagatgtccataaagtatgggacgcccttc
ctattccatgacgtggacgagtacatcgaccctgtgattgacaatgttctggagaagaac
atcaagatttcccaaggccgccagttcatcatcctgggggacaaggaagttgactatgac
tccaacttccggctctatctcaacaccaagctggccaaccctagatactccccatcggtg
tttgggaaggccatggtcatcaactatactgtcactctgaagggtctggaggaccagctg
ctgagtgtgctggtggcctatgagaggcgtgagctggaggagcagagggagcacctcatc
caagagaccagcgagaacaagaacctgctcaaggaccttgaggactcactcctgcgggag
ctggctacgtccacagggaacatgctggataatgtggagctggtgcagaccctggaagag
accaagtccaaggccacagaggtttcagagaagctgaagctggcagaaaagacagccctg
gacattgatcggctgcgggatggctaccggccggccgcgagacggggcgccatcctgttc
ttcgtgctgtccgagatggcgctggtcaactccatgtaccagtattccctcatcgccttc
ctggaggtctttgggctgtcactgaagaagtcactacctgactccatccttttgaagcgg
ctgaaaaacatcatggacacgttgaccttcaacatctacaactatggctgcaccgggctg
tttgagaagcacaagctactcttctccttcaacatgaccatcaagatagagcaggcagag
ggcagggtcccccaggatgagctagacttctttctaaaagggaacatttctctggagaag
agcaaatggaagaagccgtgcacctggctgtcagaccagggctgggaagatatcattctc
ctgtcagagaagttctcagacatcttcgggaatcttccctttgatatcgagcacaatctc
cctacctggcaggagtggtacgacaaggactcactagagcagttcccgttccccctgcgc
tatgatgaccacatcactgctttccagaaactgcttattttacgatgcttccgagtggac
cgggtgtaccgggctgtgactgactatgtgaccctcaccatgggagaaaagtatgtgcag
cccccaatgatcagctttgaggccattttcgagcagagcacccccaattcgcccattgtg
ttcatcctgagtcccggctctgaccctgccagtgacctcatgaagctggctgagcggagt
ggctttgggggcactcgcctcaagttccttgcaatgggtcaaggccaagaaaaggtggcg
ctgcagctgctggagacagcagtggctcgtggacagtggctgatgttacagaactgccac
ctcctggtcaagtggctgaaggacctggagaagtccctggagaggatcaccaagccgcac
cctgacttccgcctgtggctcaccacagaccccaccaagggcttccccattggaatcctg
cagaagtccttaaaggtggtcacggagccgccgaacgggctcaaactgaacatgagggcg
acctatttcaagatctcccacgatatgctggagcagtgtccccataccgccttcaagccc
ctggtctacgtgctggccttcttccacgccgtggtacaggagaggaggaagtttggcaag
atcggctggaacgtgtactacgatttcaatgagtctgacttccaggtctgcatggaaatc
ctaaacacatatttaacgaaagccttccagcagcacgaccctcgcattccgtggggcagc
ctcaagtaccttattggagaggtcatgtacggaggccgagccatcgacagcttcgacagg
cgcatcctcaccacgtacatggatgagtacctgggagacttcattttcgatacttttcaa
ccgttccacttcttccggaacaaggacgtggactataaaatccccgtgggtgacgtgaag
gataaattcgttgaagccattgaggcccttccactcgccaacacgccagaagtgtttggt
ctccattccaatgctgagattggctattatacacaggcagctcgcgacatgtggggccat
ctactagaactgcagccgcagaccggggagtccagcagcggcgtcagccgtgatgactac
atcggccaggtggccaaggacattgagaacaagatgcccaagatcttcgacctggaccaa
gttcggaagcatctgggcctgaacatctcacccacctcagtggtcctgctgcaggagctg
gggcgcttcaacaagcttgtcattcgtatgactaggtctctcgctgagctccagagggcc
ttggctggggaagttggaatgagcaatgagctggatgacgtagccaggtctctcttcctc
gggcacatccctcacatctggaggaagctcgcccctgacaccctgaagaccctcggaaac
tggatggtctacttcctgcggcggttcaaccagtacaccctgtgggtcacggagagcgag
cccagtgtgatgtggctctcagggctgcacatcccagagtcctatctcacagccctagtg
caggccacatgccggaggaatggctggccactggaccggtccaccttgttcacacaagtg
accaagttccaagatgccgatgaagtaaatgagcgtgcggggcaagggtgctttgtctct
gggctctacctggaaggtgctgactgggacatagagagagggtgtcttgtcaagagcaag
cccaaggtgctggttgtggacttgcccatcctgaagatcatccccattgaaggtcatcgc
ctgaagttacagaacaccttccggacccctgtctacaccacctccatgaggagaaatgcc
atgggagtcggcttagtgttcgaagctgacctctttactgcgaaacacatctcacactgg
gtgctacagggggtgtgcctcaccctgaactcagattaa

KEGG   Rattus norvegicus (rat): 117253
Entry
117253            CDS       T01003                                 

Gene name
Dnah11
Definition
(RefSeq) dynein heavy chain 11, axonemal isoform X1
  KO
K10408  dynein heavy chain, axonemal
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    117253 (Dnah11)
   05016 Huntington disease
    117253 (Dnah11)
   05022 Pathways of neurodegeneration - multiple diseases
    117253 (Dnah11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    117253 (Dnah11)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     117253 (Dnah11)
SSDB
Motif
Pfam: MT DHC_N1 AAA_6 DHC_N2 Dynein_C AAA_8 AAA_9 AAA_7 AAA_lid_11 AAA_lid_1 Dynein_heavy Dynein_AAA_lid AAA_5 AAA_16 AAA_22 Laminin_II AAA_30 AAA_25
Other DBs
NCBI-GeneID: 117253
NCBI-ProteinID: XP_038934019
RGD: 621088
Ensembl: ENSRNOG00000005451
Position
6
AA seq 4514 aa
MAAQEEGTVLRLSPSEQEDEEDEEAEAARRAQRFAVDPRVRFLGGRLQQALGFPEETWGE
YLESEDHRQVLGDFLESSGPASLVFSVAPGLLSASPEIPRDVKHKLVYFAKKMTGSTGES
DFSQTVLFGEIPRSLFTHVTAFLDEILVPILSNKNNHESWSCFISQDVEHHTEIMKNKMH
IFRGKMSRRTHLPIPTIAENIDLDQHYSVTRPQSDERRILHAIESVVIKWSHQIQEIIEK
DSAQPLLSGLHPTPETELDFWTMRHDNLKCIYHQLQAPIVLKMVKILRTRQSSYLPALKG
IFTTVENALLEARDVELHLRPLRKHIQGLQEADFPQTGILIAPLIHTICLIWSHSKFYNS
PARVIVLLQEFCNLFIDQARAYLSPEDLLKGEIEDALEKVQVAIGVLRMFQNSFFKYRRG
LTSYFTGDTEQRPWDFQSHLVFSRFNKFLDRLVKIEDMFVTILEFEKLERLEFGGSKGAV
LNAQIHSMKEEFIECCNVFRQSIYDPSDCDSMEFESDYFQFKSKTLDFDRRLGTLLCEGL
SNCSGLESAFKLLTIFGNFLEKPVVMEIFSPHYSTLLNMFNAELDMCKRLYDEHMKQIEH
GHEILNKNMPFTSGNIKWARMLLERLQMFWSNFTSLHYLFPDSPDEAAVCQKYAEMTTLL
DQFESRIYSEWRRNVDKTCEFNLNQPLVKFSPINGLLSVNFDPKLVAVLREVKYLLMLKK
SNIPDSALGIFQKKNIILKHIGNLELLVQGYNKLKQTLLEVEYPLIEKELGAIDEQLRVA
ATWLTWQDDFWVYMEKVQVATAELERRVSQTQSNVQTIQQTMQAWAEWPLLPRRETRREA
ALTLDDKGDLFAKKYKLIREDGYKIHNLVEENRKLFRADPSLDSWKIYVEFIDDIVVEGF
FQTILHDLDFFLRNTEKQLKPAPFFQAQMLLMPPEIVFKPPLEREAGDGFYNLVEAMLCG
SFKVSAQMGRVAAHLDIPDYQNDMDNMLGLAEVRQEIMNRVADVIDKVLEFRSSLETYSY
LWVDDRVEILRQFLLYGHAVPSEEIDAPAGEDILQSPTLEQFKEQIDIYEALYVQMSKFD
DFRVFNSWFKIDMRPFKLSMLNVIKKWSWMFQEHLLRFVVDSLSELQGFIKQTNAGLQRQ
PHEGDHDGLVDIMGHLLAVRSRQRATDELFEPLKETIMLLESYGQKMPEQVYAQLEELPE
RWETTKKIAAVVRHEVSPLQNAEVTLLRKKCILFDEKQAEFRERFRSYAPLGFKAENPYS
VLDKANQELEALEEEVVQMQNCARLFEVVLPEYKQMKQCRREVRLLKELWDIIVYVRRSI
DNWTETRWRQVNMEQMDLELRRFAKEIWSLDKAVRVWDAYSGLEGTVKDMTTSLRAVAEL
QNPALRDRHWQQLTNAIGVRFSINDSTTLADLLAVQLHQVEEDVRDIVDKAVKELGTEKV
ITDVSHTWEALEFSYEVHHRTGTPLLKSDEQLFETLEHNQSFLLGLGTSWLATEPLGSAY
SHAGILQVQLQTLLQSKYVEYFIDQVLSWQNKLNVADAVIFTWMQVQRTWSHLESIFVCS
EDIRIQLVEDAQRFDEVDAEFKELMFKTAKIKNVLEATCRPHLYEKLKDFQHRLSLCEKA
LAEYLETKRVTFSRFYFISSADLLDLLSKGAQPKQVTRHLVKLFDSISDLQFEDNPEVST
CKAVGMFSKEKEYVSFQAGCECIGHVESWLLQLEQTMKETVRLAIAEAIAAYEEKPRELW
IFDFPAQVALTGSQIWWTTDVGIAFSRLEEGYETALKDFHKKQISQLNTLITLLLGELSP
GDRQKVMTICTIDVHARDVVAKLISQKVVSPRAFTWLSQLRHEWEESRKHCIVNICDAHF
QYCYEYLGNSPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGMM
VYVFNCSEQMDYRSIGNIYKGLVQTGAWGCFDEFNRIAVEVLSVVAVQVKMIHDAIRSRR
RRFVFLGETIPLKPSVGIFITLNPGYAGRTELPENLKALFRPCAMVAPDTELICEIMLVA
EGFVDARSLARKFISLYTLCDELLSKQDHYDWGLRAIKSVLVVAGSLKRGDKNRPEDQVL
MRALRDFNMPKIVTDDVPVFLGLVSDLFPALDVPRQRKPHFEQMVKQSTLELRLQPEESF
ILKVVQLEELLAVRHSIFVVGNAGTGKSKILRTLNRTYVNMKQKPVWNDLNPKAVTTDEL
FGFIHHATREWKDGLLSSILREQANLTHDGPTWIVLDGDIDPLWIESLNTVMDDNKVLTL
ASNERVALTPSMRLLFETHHLQTATPATVSRAGILYVNPQDLGWNPYVASWIDRRRHQSE
KANLTILFDKYIPVCLEKLRTSFKAITSVPESSLVQTICTLLECLLTPENIPSDSPKETY
EVYFVFACVWTFGGTLLRDQLSDYQADFSRWWHKEMKAVKFPSQGTIFDYYLDHKTKKFL
PWTDKVPQFTMDADAPLKTVLVHTPETTRLRYFTELLLNKGKPLMLVGNAGVGKTVFLSD
TLASISEDYIVSRVPFNYYTTSADLQRILEKPLEKKAGRNYGPRGNKKLVYFIDDLNMPE
VDLYGTVQPHALLRQHIDYGHWYDRHKVMLKEIRNCQYVACMNPMAGSFTVDPRLKRHFT
VLAFNFPSLDTLTTIYGQIFSFYLQQQAFCPSVLRTGPSLIQATIAFHQTMAENFVPTAI
KFHYNFNLRDLSNIFQGILFASPECLKCPEDLARLWLHETSRVYGDRLVDANDSDLFQRK
MLEAAHKYFKGADANTLQQQPLVYCHFASGREDPCYEPVKDWEGLKAVLTEMMGNYNELH
SEMHLVLFEDAMQHVCRISRILRTPQGHALLVGVGGSGKQSLSRLAAYICSLEVFQITLT
EGYGTQDLRVDLANLYVRTGAKNMPTVFLLTDAHVLDESFLVLINDLLASGDIPGLFSDE
DTDKIISGIRNEVRGLGITDSRENCWAFFLARVRLQLKMVFCFSPVGHTLRVRARKFPAL
VNCTAIDWFHAWPQEALVSVSRRFIEEIEGIEPQHKDSISLFMAYVHTSVKEVSAWYYQN
ERRYNYTTPRSFLEQISLFKSLLKKKRGEVQRKKEHLGNGIQKLQTTASQVGNLKARLAS
QEAELQLRNQDAEALITKIGLQTEKVSREKAIADAEERKVAAIQTEASQKQRECEADLLK
AEPALVAATAALNTLNRVNLTELKTFPNPPNAVTNVTAAVMVLLAPRGRVPKDRSWKAAR
IFMGKVDDFLQALINYDKEHIPENCLKVVNEQYLKDPEFNPNLIRTKSFAAAGLCAWVIN
IIKFYEVYCDVEPKRQALAQTNLDLAAATEKLEAVRRKLVDLDHNLRRLTASFEKATAEK
VRCQEEVNQTNKTIDLANRLVSELESEKIRWGQSIKSFETQEKTLCGDVLLTAAFVSYIG
SFTRQYRQELVDCKWIPFLQQKVSIPIAEGLDMIATLTDDATIATWNNQGLPSDRMSTEN
ATILTHCKRWPLMIDPQQQGIKWIKNKYGPDLKVTHLGQKGFLNAIEMALAFGDVILIEN
LKETVDPVLGPLLGRNTIKKGKYIRIGDKECEFNKNFRLILHTKLANPHYKPELQAQTTL
LNFTVTEDGLEGQLLAEVVSVERPDLERLKLVLTKHQNDFKIELRHLEEDLLLRLSAAEG
SFLDDTDLVERLETTKATAAEIEHKVIEARENERKINETRECYRPVAARASLMYFVISDL
RKINPVYQFSLKAFKTLFHRAIEQADKVEDTQERICALMESVTYATFLHASQALFEKDKL
TFLSQMAFQILLRRNEIHPLELDFLLRFTVEHTYSSPVDFLTAQSWSAVKAVALMEEFRG
LDRDVEGSAKQWRKWVESECPEKEKLPQEWKKKSLIQKLIILRAVRPDRMTYALRNFVEE
KLGTKYVERTRLDLGKAFGESSPGTPVFFILSPGVDALKDLEVLGKRLGFTIDSGKFHNV
SLGQGQELVAEMALEKAAIGGHWVFLQNVHLVAKWLGTLEKLLEKFSQGSHRDYRVFLSA
EAAPSQHEPVIPQGLLENSIKITNEPPTGMLANLHAALYNFDQDTLEMCSKDQEFKSILF
SLCYFHGCVAGRLRFGPQGWSRSYPFSPGDLTICTNILYNHLEANPHVPWEDLRYLFGEI
IYGGHITDAWDRKLCRVYLEEFMNPSLIEDELMLAPGFAAPPYSDYSGYHQYIEDMLPPE
SPALYGLHPNAEIELLTVTSNMLFRTLLEMQPRNAVSNEEQGQSTEDKVKNILDDILERL
PEEFNMAEIMQKNPNRSPYILVCFQECERMNVLLREIRVSLQHLDLGLKGELTLSPDVET
QLSALSYDRVPDTWNKLAYPSTYGLAQWFNDLLLRCRELDTWTQDLTLPAVVWLSGLFNP
QSFLTAIMQTMARKNEWPLDRMCLTIDVTKKTKEDYGHPPREGAYLHGLHLEGARWDIQS
GALVDARLKELTSTMPVIFAKAIPADRQEVKHAYECPVYKTKARGLTYVWTFRLRSKDRI
AKWVLAGVALLLEA
NT seq 13545 nt   +upstreamnt  +downstreamnt
atggcagcccaggaagaagggaccgtgctgcggctcagcccctcggagcaggaggacgag
gaagacgaggaggcggaggctgcacggagagcgcaacgttttgccgtagacccccgggtg
cgcttcctgggaggccgtctgcagcaagcgctggggttcccggaggagacgtggggcgaa
tatctggagagcgaggaccaccggcaggtcctaggagactttctggagagcagtggtcct
gctagcctggtgtttagtgtcgccccggggttgctctcggcgtcccccgagattccaaga
gatgtgaaacacaagctggtttattttgcaaagaagatgactgggagcacgggagaaagt
gatttctcccaaaccgttttgtttggagaaatacccaggtcattgttcacacatgtaact
gcattcctagatgagatattagtcccaattctgtctaataagaacaatcatgagtcctgg
tcatgttttatttcacaagatgtggaacatcacacagaaatcatgaaaaacaagatgcat
atttttaggggcaaaatgtcaagaagaactcatctgccaattcctacgattgcagaaaat
attgatctggatcagcattactcagtgactcggccacaatcagatgagaggagaatactc
catgccattgaatctgtagtcattaaatggtcacatcagatccaagaaatcatagaaaaa
gattcagcacagcctctattgagtggcctccacccaacccctgagacagagctggacttc
tggaccatgaggcatgataacctgaaatgcatataccatcaacttcaggctcctattgtc
ctcaagatggttaagatactgagaacaaggcaaagcagctaccttcctgctctgaagggc
atcttcaccacggtagaaaatgctcttcttgaagcccgggatgtggaacttcacctaaga
cctctgaggaagcacattcaaggtctccaggaggcagatttcccacagaccggaatactg
attgcaccgttgattcacaccatctgtctcatctggagccattccaagttctataacagc
cctgctcgggttatagttttactgcaagagttttgtaacctcttcattgaccaggcaaga
gcatacctgtcacctgaagaccttttgaaaggagaaattgaagatgcactggaaaaggtg
caggtggccattggtgtcttaaggatgttccagaattcttttttcaagtatcgaagggga
ttaacaagctacttcacaggagacacagagcagagaccctgggatttccagtctcacctg
gtctttagcagatttaacaaatttcttgaccggctggtaaaaatagaggatatgtttgtc
accatactggaatttgagaaactggaaagactggaatttggtggcagcaagggggcagtc
ctaaatgcacaaatccactcaatgaaggaggaattcatcgagtgctgcaatgtcttccga
cagagcatttacgatccatctgactgtgacagcatggagttcgaaagtgattatttccaa
ttcaagtccaaaaccctggattttgacagaaggcttgggacgctgctttgtgagggtctc
agcaactgtagtggtttggagtctgcgtttaagcttttgaccatatttgggaattttcta
gagaaaccagttgtcatggaaattttcagcccacattatagcacactattgaacatgttt
aatgcagagttggatatgtgtaagcgactgtatgatgaacacatgaagcagattgaacac
gggcatgaaattctcaacaagaatatgccattcacctctggaaatattaaatgggccaga
atgctcctcgaacgccttcaaatgttctggtcaaactttacatctctccattatctattt
ccagacagtcctgatgaggctgcagtctgtcagaagtatgctgaaatgaccactttgctg
gatcaatttgaaagtcgcatctatagtgaatggagaagaaatgtggacaaaacctgtgaa
tttaatctgaatcagcccttggttaaattcagtcccataaacggccttcttagtgtcaac
tttgacccaaagcttgtggcggtactgagagaagtcaaataccttttgatgctgaagaag
tccaacataccagattcggctttaggcattttccagaaaaagaacattattttaaagcac
attgggaatctcgagctcctggtacaaggatacaataagctgaaacagacccttctggaa
gttgaataccctctcattgagaaagagcttggagccattgatgagcagctcagggtggct
gcaacctggttgacatggcaagatgacttctgggtctacatggagaaggtgcaggtggcc
actgccgagctagagcgcagagtgtcacagactcagagcaatgtgcaaacaatccagcaa
accatgcaggcctgggctgagtggccactgctgccccggagggagaccagaagagaggct
gccttaaccttggatgacaagggggatctgtttgctaagaaatacaagctgatccgagaa
gatggctacaagatacacaacctggtagaggagaaccggaagctcttcagagctgatcct
tccctggattcctggaaaatttatgtggaattcatcgatgacattgtggtggaaggcttt
tttcagaccatcttgcatgacctggacttcttcctgaggaacacagagaaacagttaaaa
cccgcgccattttttcaagcacaaatgctcttaatgcccccagagattgtgttcaagccc
cctttagaaagagaggctggggatggcttctacaatctggtggaggcaatgttgtgtggc
agcttcaaggtgtctgcccagatggggcgtgtggcggcacacctggacatccccgactac
cagaatgatatggataacatgttaggcctggcagaggtccggcaggagataatgaataga
gttgctgatgtcatcgacaaagttttggagttcagaagttctctggagacctactcttac
ctgtgggtagatgaccgagtagagattctgaggcagttcctcctgtatggccatgctgta
ccatctgaggaaatcgatgctcctgcaggcgaggacatcctgcagtcaccaacactagaa
cagttcaaagaacagatcgacatttatgaagctttgtatgttcagatgagcaagtttgat
gacttccgagtgtttaacagttggttcaagatagacatgagacctttcaagttgagcatg
ctcaacgtgatcaagaagtggagctggatgtttcaagagcatctgctaagatttgtcgtc
gacagtctgagtgagctgcaaggattcatcaagcagacaaacgcaggacttcagagacag
ccacatgagggtgatcacgatggcttagttgacatcatgggtcacctcctggctgtaaga
agccgacagagagctactgatgagctctttgaacctctgaaggaaaccatcatgcttctg
gaaagctatggccagaagatgcctgagcaagtctatgcccagctggaggaattacctgaa
agatgggaaaccaccaagaagatcgcagccgtggtcaggcatgaggtctcgccactccaa
aacgcagaggtcactcttctaaggaaaaaatgtattttgtttgatgaaaagcaagcagaa
ttcagagagagatttaggagctatgcccctcttggatttaaggcagagaatccatactca
gtgctcgataaggctaatcaggagcttgaggctctggaggaagaggtggtgcagatgcaa
aactgcgcacgtctcttcgaggtggttcttcccgagtacaaacaaatgaagcagtgccgc
agggaagtccggctgctcaaagagctctgggatatcatcgtttacgttaggagaagcatt
gataattggactgaaacccggtggaggcaggtcaacatggagcagatggacttggagctc
agaaggttcgccaaggaaatttggtcactggacaaggctgtccgtgtctgggatgcttat
tcaggcctggagggcactgtgaaggacatgacaacctccctgagagcagttgcagagttg
cagaaccctgccctcagggacaggcattggcagcagctgacgaacgccatcggggtcaga
ttctcgataaacgacagcacaacattggcagacttgctggcagtgcagctgcaccaggta
gaagaggacgtgagagacattgtggataaggccgtgaaggagctgggcacagagaaggtt
atcactgatgtcagccacacctgggaagccctggaattttcttatgaggttcaccataga
acaggcaccccactgctgaagtctgatgaacagctttttgagactctagaacataaccag
agtttcttactgggacttgggactagctggctagccactgaacctttgggatctgcctat
tcccatgctggaatattacaagttcagttgcagactcttcttcagagcaagtatgtggaa
tacttcattgatcaagtcctaagctggcaaaacaagctaaatgtcgccgatgcagtcatc
tttacttggatgcaagtccagcgaacctggtctcacttggaaagcatcttcgtctgttca
gaagatattcgaatccagcttgtggaagatgcccaaagatttgatgaagtagatgctgag
tttaaggagttaatgttcaagacagccaagataaaaaacgtcttagaagcaacatgcaga
ccccacctctatgagaaacttaaagattttcagcacaggctctctctttgtgaaaaagcc
ctggctgagtacctggaaaccaagcgggtcacgttctcccgcttctacttcatctcctcc
gcagacttgctggaccttctctccaagggagcacagccgaagcaggtaacacgacacctt
gtcaaactctttgacagcatctcggatctgcagttcgaagataacccggaagtgtccacg
tgcaaagcagttggaatgttcagcaaagaaaaggagtatgtctcattccaggccgggtgt
gaatgcataggccatgtggagagctggcttctgcaactggaacagaccatgaaggaaacg
gttcgcctggcgatcgcagaagccatcgcagcctacgaggagaaacctagagagctgtgg
atctttgatttcccggctcaagtggctctgactggctcacagatatggtggaccacagat
gtaggcattgccttcagtcggctagaggagggctatgaaacagccctaaaggatttccat
aagaaacagatttcacagctgaacacgctgatcacacttcttctgggagaactttcacct
ggagacaggcagaaggtcatgaccatctgcaccatcgatgtccatgccagagatgtggtg
gcaaaattgatttctcagaaggttgtcagccctcgtgctttcacctggctgtctcaactc
cggcacgagtgggaggaatcgaggaagcactgcatcgttaatatttgtgacgcccatttc
cagtactgctacgaatacttgggaaacagccctcggctggtgatcactcctctcactgac
aggtgttacatcactttaactcaatcacttcatctgaccatgagcggcgctccagctggc
ccagctggaacggggaaaacggaaaccaccaaagaccttggccgtgccttgggcatgatg
gtttacgtattcaactgctcagaacaaatggactacaggtccataggcaacatctataaa
ggactggtgcagacaggagcgtggggctgctttgatgagttcaaccgcattgctgtggag
gttctgtccgtggtggcagtgcaggtgaagatgattcatgacgccatcaggagcaggaga
aggagattcgtatttcttggggagaccatcccgctgaagccatcggttggaatattcatc
actctgaacccaggatatgctggtcgaaccgaattaccagaaaacctcaaagctctgttc
agaccctgtgccatggtggcccctgatactgagctgatctgtgaaatcatgttggtggca
gaagggtttgtggatgcgcggtcattggcccggaagttcatttccttgtacacgctctgt
gacgaactgctgtccaagcaggatcattatgactggggacttcgtgccatcaagtctgtc
ttggttgtagccggctccctgaaacgaggagataaaaatagacccgaagaccaggtgctc
atgagagcattgcgagacttcaatatgcctaaaattgtaactgatgatgtcccagtgttc
ctgggcctggttagcgacctatttccagccttggatgtgcctcggcagaggaaaccacac
tttgaacagatggtcaagcagtctaccctggaactccgcttgcagcctgaggagagcttc
atcctcaaagttgtccagcttgaggagctgctggccgtgcggcactccatctttgtggtt
ggaaatgcaggcacaggaaagagtaagattttgagaacactgaacagaacatatgttaac
atgaaacagaagcctgtttggaatgacttaaaccccaaggctgtgacaacggatgaactc
tttggtttcattcatcatgctacccgagaatggaaagatggtctcctctcgtccattctg
agagagcaggcaaatctcacacatgatgggccaacctggatagtcctggatggtgatatt
gacccactgtggatcgagtccttgaacacggtcatggatgataacaaggtgctgaccctc
gccagcaatgaacgagtggccctcacaccctccatgaggcttctgtttgagacccaccac
ctacagacagccacaccagccacggtctccagagctggcattttgtatgtgaacccgcag
gacctgggctggaacccgtatgtggccagttggatagacagaaggcggcatcaatcagaa
aaggccaatttaactattctttttgataaatacattcccgtgtgcttggagaagctaaga
actagctttaaagccatcacttctgttccagagagcagcctggtgcagacaatttgtact
cttttggagtgtttgctgactccagagaacataccttctgacagtcctaaagagacctat
gaggtctattttgtcttcgcttgtgtctggacatttggaggcaccctactacgagatcag
ctttctgattaccaagccgacttcagtagatggtggcataaggaaatgaaagcagtgaag
tttccatcccagggaaccatctttgattattatctggaccacaaaactaaaaaatttttg
ccttggactgacaaggtcccccagttcaccatggatgcagatgcgcccctgaagacagtc
ctggtacacacaccagagacaactcgtcttaggtattttactgagttgctacttaacaaa
ggcaaacctctgatgctggttggaaatgcgggagtgggaaaaaccgtctttttgagcgac
accctggcaagtatttctgaggactatatagtgtcccgtgtgcctttcaactactacacg
acatcggcagacctgcagagaattcttgaaaaacctctagagaaaaaagctggtcgtaac
tatggtccaagaggaaataaaaaactggtttacttcattgatgatctgaacatgcctgaa
gtggatttgtatggcaccgttcagcctcatgcactgcttcgacagcatattgactatggg
cactggtatgaccgacacaaagtgatgctcaaggaaatccgcaactgccagtacgtagcc
tgcatgaatcccatggcaggcagctttaccgtggacccaaggctgaagagacatttcacc
gtgctcgcattcaactttccatctttggacacgctgaccaccatctacggtcagatcttc
agcttctatctccagcagcaagcattctgcccgtcggtcctcaggactggcccatctttg
atccaggcaaccatcgccttccatcagacgatggcagagaactttgtgcccacagctatt
aaattccattacaattttaatctaagagacttatcaaacatcttccagggaattctgttt
gcctctcctgagtgtttaaaatgcccagaagacttagcacgcctgtggcttcatgaaaca
tcacgtgtttatggagacagactggtagacgcaaacgattccgacttatttcagaggaaa
atgctggaagctgcccataagtacttcaaaggtgcagatgctaacacgctgcagcagcag
cccctcgtctactgtcactttgccagtggcagggaagacccttgttacgagcccgtgaag
gactgggaagggctaaaggcagttcttacagagatgatgggcaactacaatgagctgcac
tccgagatgcacctcgtgctctttgaagacgccatgcagcacgtgtgccgaatcagccgc
attcttcggacccctcaaggccacgccctcttggttggagttggaggcagtggcaagcaa
agcctgtctaggctggcagcttacatctgcagcttggaggtctttcagatcactctgaca
gaaggctatgggacccaagatctccgggtagatctggccaatttgtacgtcagaactgga
gccaagaacatgcccaccgtgttcctgctgacagatgcccacgttctagatgagagcttc
ctcgtgctgattaatgacttgctggcatcgggagacatcccaggtctgttcagtgacgaa
gataccgacaagatcatttctgggattcgtaatgaagttcgaggcctcggcataacagac
tccagggagaactgttgggcattctttttggccagagtccgactacagctcaaaatggtt
ttttgtttctcaccggttggtcacactctgagagttagagcccggaagttcccagcccta
gttaactgcacagctattgactggtttcatgcatggccacaggaagctctggtctcagtc
agcaggaggtttattgaagaaatcgaggggattgagccacagcacaaagattctatcagc
cttttcatggcgtatgttcacaccagtgtaaaggaagtaagtgcctggtactaccagaac
gagaggaggtacaactacaccaccccaaggagtttcttagaacaaatatcactgtttaag
agcctgctgaagaagaagcgaggagaggtgcagcggaagaaggagcacctggggaatgga
atccagaagctgcagaccacggcctcacaggtgggaaatctgaaggccaggctggcctct
caagaagctgagctgcagctcagaaaccaggacgccgaggccctgatcacaaagatcggg
cttcagacggagaaagtgagccgggaaaaggccatcgcagatgcagaggagcgaaaggtg
gccgccattcaaactgaagcgtcccagaagcagagggagtgcgaggctgacttactcaag
gctgagcccgccctggtcgctgctacagctgcactcaatacactcaacagggtaaacctc
acagaactgaaaaccttccccaaccccccaaatgctgttaccaatgtaactgcagctgtg
atggtccttctggccccccgaggcagagtgccaaaagacagaagttggaaagcagccaga
atcttcatgggaaaggttgatgatttcctacaagcgttaattaactatgataaagagcac
attccagagaactgtctaaaagtagtaaatgaacaatatttgaaagatccggagtttaat
ccaaacctgattcggaccaagtcttttgcagcagctggtctctgtgcctgggtcatcaac
atcattaagttttatgaggtttattgtgacgtggagcccaaacgtcaggcattggcccaa
acaaacttagacctggctgcagctactgaaaagttagaggccgtcaggaggaagctcgtg
gatctggatcataatctgagaagacttacagcttcatttgaaaaggcaacagctgagaag
gtccggtgtcaggaagaagtgaatcaaaccaataagacgattgacttggccaacagacta
gtcagtgaacttgagtcagagaagattcgatggggtcagtccattaagtcttttgaaact
caagagaagacactgtgtggagatgtgctgctcacggcagcgtttgtgtcttacattggg
tccttcacaagacagtatcgccaggaactggtggactgcaagtggattccatttcttcag
cagaaggtttccatcccaatagcggaaggcctggacatgattgccacgttgacagacgat
gctacaattgccacctggaataaccaagggctacccagcgacaggatgtcaactgaaaat
gccaccattctaactcactgcaagcgctggcccctgatgatcgatccccagcaacaggga
attaaatggatcaagaataaatacgggcctgacctgaaagtcacacacttaggccagaaa
gggtttttaaatgccattgagatggccctggcctttggtgatgtcatcctaattgagaac
ctcaaggagacagtggatccagtcctgggtcctctgcttggcaggaacaccattaagaaa
ggaaagtacatcaggattggtgataaagaatgtgaattcaacaagaacttccgcctcatc
ctacacacgaaactggcaaacccacactacaagccagaactacaagcccagacgaccctc
ctcaatttcacagtcacagaagatggtcttgaaggccagctgctggcagaggtagtcagt
gtcgaaaggccagatttggagaggctaaagctagttttgaccaagcaccaaaacgacttt
aagatagagctgaggcatcttgaggaggaccttctcctgcgcctctctgctgcagagggg
agcttcctggatgacacggacctggtagagcgcctggagaccaccaaggccactgcagca
gaaatagagcacaaggtgatagaggccagagaaaatgagagaaaaatcaacgagacccgt
gagtgctacagaccggtggcagcaagagcctcccttatgtactttgttatcagtgacctc
cggaaaatcaaccccgtctaccagttctctctgaaggctttcaagacactgttccacaga
gccattgagcaagctgacaaggtggaggatactcaggagcgcatctgtgccctaatggag
agtgtcacctatgctaccttcctccatgccagccaagcactgtttgagaaagacaagctc
acatttctgtcccagatggcttttcagatcttgttgagaaggaatgagatccaccccctc
gagttggacttcctgcttcggttcacggttgaacacacctactcgagccctgttgacttt
ctaactgctcagtcatggagtgctgttaaggcagtcgccctcatggaggaattccgaggc
ctagaccgagatgtggaaggatctgccaagcagtggaggaaatgggtagagtccgagtgc
ccggaaaaagaaaagttaccgcaagaatggaagaagaaaagtttaatacagaaactgatt
attttgagagcagtgcggcctgacaggatgacatatgccctgagaaattttgtagaggag
aagctaggtacgaagtacgtggagagaacgagattggatctgggtaaagcatttggagaa
agcagcccaggcaccccagtgtttttcatcctgtccccaggcgttgatgcccttaaagac
ttagaggtgcttggcaaaaggctgggatttacgattgactctggaaaattccacaatgtg
tctctagggcaaggtcaggaactagtggcagaaatggcgctggagaaagcagccattgga
ggacactgggtcttccttcagaatgttcatctggtagccaaatggctgggaaccttggag
aaactccttgaaaagttcagtcaaggaagccacagggattacagggtgttcctgagtgcc
gaggctgcaccttcccaacacgagcctgtcatccctcaaggcctcctggaaaattccatt
aagatcaccaacgagccccccacaggaatgctggccaacctgcatgctgctctatacaac
tttgaccaggatacgctcgagatgtgctccaaggatcaggagtttaaaagcatcctcttc
tccctgtgttacttccatggctgcgtggcagggagactgaggtttggtccccagggctgg
agccgaagctatcctttcagcccgggagacctgaccatctgcaccaacatcctctacaac
cacttagaggcaaaccctcacgtcccgtgggaagacctccgttacctctttggagagatc
atatatgggggccatatcacagatgcctgggatcgcaaactatgccgggtgtatctagaa
gaattcatgaatccatctctgattgaggatgaactcatgctggcaccaggatttgcagcc
cctccctactctgattattctggctaccaccagtacatagaagacatgttgcctccagaa
agcccggcactgtatggcctccaccccaatgctgaaatagagttactaacagtgacgtcc
aacatgctcttcagaactctgctggagatgcaacccaggaatgcagtcagcaacgaggaa
caggggcagtccacagaagacaaggttaagaatatcttggacgacattttggagagactt
ccagaagagttcaacatggcggagataatgcaaaagaacccaaatagaagcccgtatatt
ctcgtttgctttcaagagtgtgagaggatgaacgttctcctccgggaaatccgtgtgtcg
cttcaacacttagaccttggtttgaagggagagttaacattgtctcctgatgtggaaacc
cagctgtccgccttgagttatgaccgggtcccagacacatggaacaaactggcttatcca
tctacttacggcctggcccagtggtttaatgacctcctcttacgctgccgggaactggat
acttggactcaagacctcaccctccctgctgttgtgtggctttctgggctcttcaaccct
caatctttcttaacagcaatcatgcagaccatggctcgaaaaaatgagtggccactggac
agaatgtgtttgactattgatgtcactaagaaaacgaaggaagattatggccaccccccc
agagaaggtgcatatcttcatgggctccacctggaaggtgccaggtgggacatccagtca
ggagcccttgttgatgcccgtcttaaggagttaacatccacgatgccagtcatcttcgcc
aaagccatacccgcagacagacaagaagttaagcatgcctatgagtgccccgtttacaaa
accaaagcgagaggcctcacctacgtgtggacgttcaggctaaggagcaaagacaggata
gctaagtgggtcctggcaggtgtagctctactactagaagcataa

KEGG   Rattus norvegicus (rat): 171339
Entry
171339            CDS       T01003                                 

Gene name
Dnah1
Definition
(RefSeq) dynein heavy chain 1, axonemal
  KO
K10408  dynein heavy chain, axonemal
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    171339 (Dnah1)
   05016 Huntington disease
    171339 (Dnah1)
   05022 Pathways of neurodegeneration - multiple diseases
    171339 (Dnah1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    171339 (Dnah1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     171339 (Dnah1)
SSDB
Motif
Pfam: AAA_6 DHC_N2 Dynein_C AAA_8 AAA_9 AAA_7 MT AAA_lid_11 Dynein_heavy Dynein_AAA_lid AAA_lid_1 AAA_5 AAA_22 AAA_16 AAA_18 DUF3450 T2SSE DUF5798 SesA TBK1_CCD1
Other DBs
NCBI-GeneID: 171339
NCBI-ProteinID: NP_001028827
RGD: 621795
Ensembl: ENSRNOG00000026914
UniProt: Q63164 D3ZRN8
Position
16
AA seq 4250 aa
MEECDKEEASTSSQGPGYCPANVPENHDLEKMLKESSRNPEKTSPNPELKTPPLPLSDLG
QPRKSPLAGTDKKYPIMKQRGFYSDILSPGTLDQLGDVCCGPYLSQNLIRQADLDKFTPK
AESFVIPEDFQERVEQQSIGTTTRLLTQTDFPLQSYEPKVQVPFQVLPGRCPRKIEIERR
KQQYLRLDIEQLLANEGIDSNKLMPRHPDLQQPQTIEQGRDPLFPIYLPLKVFDNEEFDC
RTPTEWLNMGLEPDAQYRKPVPGKALLPTDDALGHEDPKSQELDYRWCEVGVLDYDEEKK
LYLVQKTDKRGLVRDEMGMPIVNGGVTPEGRPPLLDTQYWVPRIQLLFCAEDPRVFTQRV
VQANALRKNTEALLLYNLYVDCMPTEGQRVINEQSLSKIKQWALSTPRMRKGPSVLEHLS
SLAREVNLDYERSMNKINFDQIVSSKPETFSFVTLPEKEEEKVPNQGLVSVPEYPFREQK
EDFTFVSLLTRSEVITALSKVRAECNKVTSMSLFHSNLSKYSRLEEFEQIQSQTFSQVQM
FLKDSWISTLKVAMRSSLRDMSKGWYNLYETNWEVYLMSKLRKLMELIKYMLQDTLRFLV
QDSLGSFAQFIGDACCSVLECIDDMDWGEDLINSPYKPRKNPLFIVDLVLDNTGVHYSTP
LEQFEVILLNLFDKGILATHAVPQLEKLVMEDIFISGDPLLESVGLHEPLVEELRANITN
AMHKAMIPLQAYAKEYRKYLELNNNDISTFLKTYQTQCPSAEEVREVVITHLKEKEILDN
SLPSSIIIGPFYINVDNVKQSLSKKRKALATSMLDILAKNLHNEVDSICEEFRSISRKIY
EKPNSIEELAELRDWMKGIPEKLVILEERIVKVMSDYEVMDEFFYNLTTDDFNDKWAANN
WPTKILGQIDMVRQQHVEDEEKFRKIQLMDQNNFQEKLEGLQLVVAGFSTHVEIARAHEI
ANEVRRVKKQLKDCQQLAMLYNNRERIFGLPITNYDKLSRMVKEFQPYLDLWTTASDWLR
WSESWMNDPLSAIDAEQLEKNVIESFKTMHKCVKQFKDIPACQDVALDIRARIDEFKPYI
PLIQGLRNPGMRNRHWEVLSNEININVRPKANLTFARCLEMNLQDYIESISKVAEVAGKE
YAIEQALDKMEKEWASILFNVLPYKETDTYILKSPDEASQLLDDHIVMTQSMSFSPYKKP
FEQRINSWETKLKLTQEVLEEWLNCQRSWLYLEPIFSSEDITRQLPVESKRYQTMERIWR
KIMKNAYENREVINVCSDQRLLDSLRDCNKLLDLVQKGLSEYLETKRTAFPRFYFLSDDE
LLEILSQTKDPTAVQPHLRKCFENIARLLFQEDLEITHMYSAEGEEVKLSFSIYPSSNVE
DWLLEVERSMKASVHDIIEMAIKAYPTMLRTEWVLSWPGQVTIAGCQTYWTLEVAQALEA
SSISSSLFPQLSKQLSDLVALVRGKLSRMQRMVLSALIVIEVHAKDVVSKLIDENVVSVH
DFEWISQLRYYWTNNDLYIRAVNAEFIYGYEYLGNSGRLVITPLTDRCYLTLTGALHLKF
GGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEF
NRIDIEVLSVVAQQITTIQKAQQQRVERFMFEGVEIPLVPSCAVFITMNPGYAGRTELPD
NLKALFRPVAMMVPDYAMIAEISLYSFGFNEANVLAKKITTTFKLSSEQLSSQDHYDFGM
RAVKTVISAAGNLKRENPTMNEELICLRAIRDVNVPKFLQEDLKLFSGIVSDLFPTTKEE
ETDYGILDQAIRKACEKNNLKDVEGFLIKCIQLYETTVVRHGLMLVGPTGSGKSNCYRIL
AAAMTSLKGKPSISGGVYEAVNYYVLNPKSITMGQLYGEFDLLTHEWTDGIFPSLIRAGA
IASDTNKKWYMFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLTEAMTMMFEVQDLAVA
SPATVSRCGMVYLEPSILGLMPFVECWLKHLPSIIKPYEEQFKTLFVKFLESSIAFVRTT
VKEVVASTNSNLTMSLLKLLDCFFKPFLPREGLKKIPSEKLSHIPELIEPWFIFSLVWSV
GATGDHSSRLNFSQWLKIKMVFEQIKLAFPEEGLVYDYRLDDAGISSTEDDDEDDEESKQ
VAWVKWMDYSVPFTMMPDTNYCNIIVPTMDTMQMSYLLGMLITNHKPVLCIGPTGTGKTL
TVSNKLLKNLPLEYISHFLTFSARTSANQTQDLIDSKLDKRRKGVFGPPLGRNFIFFIDD
LNMPALETYGAQPPIELLRQWMDHGGWYDRKIIGAFKNLVDINFVCAMGPPGGGRNAITP
RLTRHFNYLSFIEMDEVSKKRIFSIILGCWMDGLLGEKSYREPVPGAPNIVHMTEPLVNA
TISIYAIITSQLLPTPAKSHYTFNLRDLSKVFQGILMAEPAKVEDKVQLLRLWYHENCRV
FRDRLVNEEDRGWFDGLLEMKMEDLGVAFNKVCPFQPILYGDFMSPGSDVKSYELITSEN
KMMQVIEEYMEDYNQINTAKLKLVLFVDAMSHICRISRTLRQALGNALLLGVGGSGRSSL
TRLASHMAEYECFQVELSKNYGMSEWREDVKKILLKAGMQNLPITFLFSDTQIKNESFLE
DINNILNSGDIPNLYSADEQDQIVNTMRPYIQEQGLQPTKANLMAAYTGRVRNNIHMVLC
MSPIGEVFRARLRQFPSLVNCCTIDWFNEWPAEALQSVATRFLHEIPELECSSEVIEGLI
HVCVYIHQSVAKKCVEYLAELARHNYVTPKSYLELLNIFSILIGQKKMELKTAKHRMKSG
LDKLLRTSEDVAKMQEELEIMRPLLEEAAKDTLLTMDQIKVDTAIAEETRKSVQAEEIKA
NEKASKAQAIADDAQKDLDEALPALDAALASLRNLNKNDVTEVRAMQRPPPGVKLVIEAV
CIMKGIKPKKVPGEKPGSKVDDYWEPGKGLLQDPGRFLESLFKFDKDNIGEAVIKAIQPY
IDNEEFQPAAIAKVSKACTSICQWVRAMHKYHFVAKAVEPKRQALREAQDDLEVTQRILE
EAKHHLREVEDGISTLQAKYRECVTKKEELEMKCEQCEQRLGRADKLINGLADEKVRWQD
TVENLENMLDNIFGDVLVAAGFVAYLGPFTGQYRAALYEYWVNQLTVYGVPHTSKPTLIS
TLGNPVKIRSWQIAGLPNDTLSVENGVINQFSQRWTHFIDPQGQANKWIKNMEKESGLDV
FKLSDRDFLRSMENAIRFGKPCLLENVGEELDPALEPVLLKQTYKQQGNTVLKLGDTVIP
YHEDFRMYITTKLPNPHYSPEVSTKLTLINFTLSPSGLEDQLLGQVVAEERPDLEEAKNQ
LIISNAKMRQELKDIEDQILYRLSSSEGNPVDDVELIKVLEASKMKAAEIQAKVRIAEQT
EKDIDLTRMEYIPVAVRTQILFFCVSDLANVDPMYQYSLEWFLNIFLSGIANSERADNLK
KRIVNINRYLTFSLYSNVCRSLFEKHKLMFAFLLCVRIMMNEGKINQGEWRYLLSGGSIQ
TMSENPAPHWLSDRAWRDILALSNLPAFSTFSTDFVQHLPKFQAIFDSAEPHREPLPGIW
NTYLDEFQKLLILRCLRGDKVTNAMQDFVANHLEPRFIEPQTANLSAVFKESNSTTPLIF
VLSPGTDPAADLYKFAEEMKFSKKLSAISLGQGQGPRAEAMMRNSIERGKWVFFQNCHLA
PSWMPALERLIEHINPDKVHRDFRLWLTSLPSNKFPVSILQNGSKMTIEPPRGVKANLLK
SYNSLSDDFLHSCQKVVEFKSLLLSLCLFHGNALERRKFGPLGFNIPYEFTDGDLRICIS
QLKMFLDEYEDIPYKVLKYTAGEINYGGRVTDDWDRRCVMNILEDFYNPAVLSPEHRYSK
SGIYHQIPPTYDLNGYLSYIKSLPLNDMPEIFGLHDNANITFAQNETFALFGAILQLQPK
SSSMGGQSREELVEDVAEDILVQVPKPVDLEEVVNKYPVLYEESMNTVLVQEVIRYNKLL
MVITQTLSDMLKAIKGLVVMSLELELMSTSLYNNAVPELWKSKAYPSLKPLASWIMDLLQ
RLNFLHSWIKNGIPSVFWISGFFFPQAFLTGTLQNFARKFVISIDTITFDFKVLSYASSE
IAERPSTGCYIYGLFLEGARWDPFDFQLAESRPKELYTEMAVIWLLPVANRKVQNQDFYL
CPIYKTLTRAGTLSTTGHSTNYVIAVEIPSNQPQRHWIKRGVALICALDY
NT seq 12753 nt   +upstreamnt  +downstreamnt
atggaggagtgtgataaagaagaagcgagcactagctctcagggcccaggatactgtcca
gcgaacgttcctgaaaatcatgacctggagaagatgttaaaagaatcaagccgtaatcca
gaaaagacttccccaaatcccgaactcaagaccccacctttacccctctcagacttaggg
cagcccaggaagtcgcctttggcaggcaccgataagaagtaccccatcatgaagcagcgt
ggattctattccgacatcctcagccctggaaccttagaccagcttggggatgtgtgctgt
gggccctacctgtcccagaatttgattcgtcaagccgacctcgacaagttcaccccaaaa
gctgaatcgttcgtcattcctgaggactttcaggagcgtgtagagcagcagagcatcggg
actaccacgcggctgctcacccagactgacttccctctacagtcctatgagcccaaggtg
caggtcccattccaggtgctgcccggacgttgccctcggaagattgagattgagaggagg
aaacagcagtatctacgcctggacattgagcagctgctggccaatgagggcattgactct
aacaagctcatgcccagacacccagacctgcagcaaccacaaaccatcgagcagggccgt
gacccactctttcccatttatctcccactgaaggtgtttgataatgaagagtttgactgc
cggactcccacagagtggctcaacatgggcttggagccagacgcacaatacaggaagccc
gtccccggaaaagcccttcttcccacagacgacgccctggggcacgaggaccccaagagt
caggaactggactacagatggtgtgaagttggtgtccttgactatgacgaagaaaagaaa
ctgtacttggtgcagaagactgacaagagaggcttggtgcgagatgagatggggatgccc
atcgtgaatggaggggtcacccctgaaggaaggccaccactcttggacacccagtactgg
gtcccgaggatccagctcctcttctgtgctgaggacccacgagtgttcacacagcgtgtg
gtccaggccaacgctctgcgcaagaacacagaggcgctgttgctctacaacctgtacgtg
gattgcatgcccacggaaggccagcgggtcatcaacgagcagagcttgagcaagataaaa
cagtgggctttgagcacaccacgcatgcgcaaggggccgagcgtcctggagcaccttagc
agcctggccagagaagtgaacctggactatgaacgcagcatgaacaagatcaactttgac
cagattgtctcttctaagccagagacattctcctttgtgactcttcctgaaaaagaggaa
gaaaaggtgcccaatcaagggctggtgagtgtccccgaataccccttccgggagcaaaag
gaggatttcactttcgtgtccctgctcactcggtcagaggtcatcacagctctgagcaaa
gtgcgggctgagtgcaacaaggtgacctccatgtccctgttccattccaacctctccaag
tacagccgcctggaggaatttgagcagatccagtctcaaaccttctcccaggtgcagatg
ttcctcaaggacagctggatcagcacactgaaagtagccatgcgcagcagcctccgggac
atgagcaagggctggtacaacctctacgagaccaactgggaggtgtacctcatgtcgaag
ctgcgcaagctgatggagctcatcaagtacatgctgcaggacacgctgcgcttcctggtg
caggactccctgggcagcttcgcacagttcatcggcgacgcctgctgcagtgtgcttgag
tgcatagacgacatggactggggcgaagacctcatcaacagtccctacaagccccggaag
aatcctctgttcatcgtagacttggtgctggacaacacgggggtgcactacagcacaccg
ctggagcagtttgaggtgattctgctcaacctctttgacaagggtatcctggccacccat
gctgtgccccaactggagaagctggtgatggaggacatctttatcagtggtgaccctctg
ctggagtcagtggggcttcacgagccactagtagaagagctacgtgctaacatcaccaat
gctatgcacaaggccatgataccactgcaggcctatgctaaggagtacagaaagtatctg
gagctgaacaacaacgacattagcaccttccttaagacctatcagactcagtgcccatca
gcagaggaggttcgggaagtggtaatcacccacctgaaagagaaggagatcctagacaac
tcattgcccagcagcatcatcattggtcccttctacatcaatgtcgacaacgttaagcag
agcctgtccaaaaaacgcaaggccctggccacttctatgctggatatcctagccaagaac
ttacacaacgaggtagacagtatctgcgaggagttccgcagcatcagccgcaagatctac
gagaagcccaacagcatcgaggagcttgccgagcttcgagactggatgaagggcatccct
gagaagctggtgattctggaggagcggatcgtaaaggtcatgtctgactacgaggtcatg
gatgaattcttttacaaccttaccactgacgacttcaatgacaagtgggctgccaacaac
tggcccacgaagatcctcgggcagatagatatggtgcggcaacagcatgttgaggatgag
gagaaattccgcaaaatccagctcatggaccagaacaacttccaggagaagctggaaggg
cttcagctggtggtggctggcttctccacccatgtggagattgcacgagcacacgagatt
gccaacgaggtgcggcgggtcaagaagcagctaaaggactgccagcagctggcgatgctg
tacaacaaccgcgagcgcatctttggcttgcctatcaccaactatgacaagctctcaaga
atggtgaaggaattccaaccctacctggacctctggaccacagcctcagactggctgcgc
tggtctgagagctggatgaacgatcctctgtcagccattgacgctgagcagctggagaag
aacgtcatcgagtcgttcaagaccatgcacaagtgcgtgaagcagttcaaggacatccca
gcctgccaggatgtggctttggatatccgagcacgcatagacgagttcaagccgtacata
ccgctgatccaaggcctgcgcaaccctggcatgcggaaccgccactgggaggtgctgtcc
aatgagatcaacatcaacgtcaggcccaaggccaacctgacctttgcccgctgccttgag
atgaaccttcaggactatattgagagtatcagcaaggtggctgaggtggctggcaaggag
tatgctattgaacaggcactagacaagatggagaaggaatgggcttccatcctgttcaac
gtgctgccctacaaggagacagacacttacatcctcaagagcccagatgaagcctcgcaa
ctgctcgatgaccacatcgtcatgactcagagcatgtctttttcaccgtacaagaaaccc
tttgagcagcgcatcaactcctgggagaccaaactgaagctgacccaggaggtgctagag
gagtggctgaactgccagaggtcctggctctacctggagcccatcttcagttctgaggac
atcacccggcagctgcccgtggagagcaagcgctaccaaaccatggagcggatctggagg
aagatcatgaagaatgcctatgaaaaccgggaggtaatcaatgtgtgctctgaccagagg
ctgctggacagcctcagggactgcaacaagttactggacctggtacagaagggcctcagc
gagtacctggagaccaagcggactgccttccccagattctacttcctgtcagatgatgaa
ctactggagatcctgtcacagacaaaggaccccacagccgtgcagccccacctgcgcaag
tgcttcgagaacattgcccggctgctgttccaggaggatttggagatcacacacatgtat
tcggcagagggggaagaggtgaagctgtccttctccatctacccctccagcaatgtggag
gactggctgctggaggtggagcgtagcatgaaggccagtgtgcacgacatcatcgagatg
gccatcaaggcctaccctacaatgctcagaactgagtgggttctgagctggccgggccag
gtgaccattgctggttgccagacatactggacattggaggtagcccaggcacttgaggcc
agcagcatcagtagcagcctcttcccccagctctccaaacagctcagtgacctggtggcc
ctcgtgcgggggaagttgtcccgcatgcagcggatggtgctgtcggcactcatcgtcatc
gaggtccacgccaaggacgtggtgagcaagctgattgacgagaacgtggtcagcgtacat
gactttgagtggatctcacagctcaggtactactggacaaataacgacctgtacatccgt
gctgtgaatgcggagttcatctacggctacgagtacctcggcaacagtgggaggctggtg
atcacacccctcactgacaggtgctatctgaccctgacaggagccttgcacctcaagttt
ggaggtgccccagctggcccagctggcacagggaaaacagagaccacaaaggacctgggg
aaggccttggccatacagacagttgtgttcaactgctccgaccagctcgacttcatggcc
atgggcaagttcttcaagggtctggccagtgcgggggcctgggcgtgctttgatgagttt
aatcggatcgacatcgaggtgctgtccgtggtggcacagcagatcaccaccatccagaaa
gcacagcagcagagggtggaacgcttcatgtttgagggtgttgaaatcccccttgtacca
tcctgtgctgtgtttatcaccatgaacccagggtatgctggccgcacagagctgcctgac
aatctgaaggccctcttccgacctgtggccatgatggtccccgattacgccatgattgct
gagatctcactctattcctttggcttcaatgaggccaatgtgctggctaagaagatcacc
accaccttcaagctgtcttctgagcagctcagctcccaggaccactatgatttcgggatg
agagccgtgaagactgtcatctcagcagccgggaaccttaagagagagaaccctaccatg
aatgaggagctgatctgccttcgggccatccgggatgtgaatgtacccaagttcctgcag
gaagacctcaagctcttctcggggattgtgtctgacctgttccctaccaccaaggaagag
gagaccgactatggcatcctggaccaggccatccgcaaggcctgtgagaaaaacaacctc
aaggatgtggagggcttcctgatcaagtgcatccagctgtacgagaccacagtggtacgg
cacggcctcatgcttgttggacccaccggctctggcaaaagtaattgttacagaatcctg
gcagctgccatgacatcgctgaaagggaagccatccattagtggtggcgtgtacgaagct
gtcaactactacgtgctcaaccccaagtccatcacaatgggtcagctgtatggggagttt
gacctgctcacccatgagtggacagatgggatcttcccctccctcatccgggctggtgcc
atcgcttctgacaccaataagaaatggtacatgtttgacgggccggtggatgctgtctgg
atcgagaacatgaacactgtgctggatgacaacaagaagctgtgcctcagctctggggag
atcatcaaactcacagaggcaatgaccatgatgttcgaggtgcaggacttggcagtggcc
tcgccagccacagtttctcgctgcggcatggtgtacctggagcccagcatcctagggctc
atgccattcgttgagtgctggctaaaacatctcccttccataataaagccctacgaggag
cagttcaagacactctttgtcaagttcctggagagctccatcgcctttgtccgaaccaca
gtgaaggaagtggttgcctcaacgaacagcaacctgaccatgagcctcctcaaactactc
gactgtttcttcaagcctttcctacccagagagggcctcaagaagataccgtctgaaaag
ctgagtcatatcccagagctgatagagccctggttcatcttctccctggtctggagtgta
ggcgccacaggagaccacagcagtcgcctcaacttcagccagtggctaaagataaagatg
gtgttcgaacagataaaactagctttcccagaagaagggctggtgtacgattaccgactg
gatgacgcagggatcagcagcactgaggatgacgatgaggacgatgaggagagcaaacag
gttgcctgggtaaagtggatggactactcggttccattcaccatgatgccagacaccaac
tactgcaacatcattgtgcccaccatggacaccatgcagatgtcctacctgctgggcatg
ctgatcaccaaccacaagcctgtgctgtgtatcgggccgacgggcacagggaagacgctc
acagtctctaacaaactcctcaagaacctgccactggaatacatcagccacttcctcacc
ttctcagcccgcacttcagccaaccagacccaggacctcattgacagcaagctggacaag
aggcgaaagggtgtgttcgggccacccctggggcgcaacttcatcttcttcattgacgac
ctgaacatgccagccctggagacgtacggcgcccagccacctattgagctgttgcgccag
tggatggaccatggtggctggtatgaccgaaagatcatcggagccttcaagaacctggtg
gatatcaactttgtctgtgccatgggtcccccagggggaggcaggaacgccatcactcca
aggctgacacgtcacttcaactacctgtctttcattgagatggatgaagtcagcaagaag
cgcatcttctctataatcctgggatgctggatggatggactccttggagagaaaagttac
cgagagcctgtgcctggggcccccaacatcgtccacatgacggagcccctcgtgaacgct
accatcagtatatatgctatcattacctcccagctgctgcccacaccagccaagtcccac
tatacctttaacctgagggacctgtccaaagtcttccagggaattctcatggctgaacca
gctaaggttgaggacaaggtgcagctgctgcggctgtggtaccatgagaactgccgtgtg
ttccgtgaccgcctagtgaatgaggaagatcgcggctggtttgatggtctccttgaaatg
aagatggaggatttgggggtggccttcaacaaagtttgtcccttccaacccattctttat
ggggacttcatgtccccaggctcagatgtaaagtcctacgagctcatcaccagtgagaat
aagatgatgcaggtgatcgaggagtacatggaggattacaaccagatcaacacagccaag
ctgaagctggtcctctttgtggatgccatgagccacatctgccgcatcagccgaaccctg
cgccaggctctgggcaacgcgctcctgttgggcgtgggtggcagtggccgcagctccctc
actcggctggcctcccacatggcggaatatgagtgcttccaggttgagctgtccaagaac
tacggcatgtctgagtggcgtgaagatgtcaagaagattctgctcaaggctggcatgcag
aacctgcccatcaccttcctgttctcagacactcagatcaagaacgagtccttcttggag
gacattaacaacatcctgaactcaggtgacatccccaacctctacagtgcagatgagcaa
gaccagatcgtcaacaccatgcggccctacatacaggagcagggcctgcagccgaccaaa
gccaatctcatggccgcctataccgggcgtgtgcgtaacaacatccacatggtgctgtgc
atgagtcccattggagaggtcttccgtgctcgcctgaggcagttcccctcacttgtcaac
tgctgcaccattgactggtttaacgagtggcccgcagaggccctgcaatctgtggccacc
aggttcctgcatgagatcccagaactggaatgttcgagtgaagtaattgaaggactgatt
cacgtttgcgtgtatatccaccagtccgtggccaagaaatgtgtcgagtacctggcagag
ctggcccgccacaactacgtgacccccaagagctatttggagctgctcaatattttctcc
atcctcattggacagaagaaaatggaactgaagacggccaaacaccgaatgaagagtggc
cttgacaagcttctgcgcacctcggaggatgtggccaagatgcaggaggagctggagatt
atgcgccccctgctggaagaagctgccaaggacaccttgctcactatggaccagatcaag
gtggacacagccatagctgaagagacccggaaatcagtgcaggcagaggagatcaaggcc
aacgagaaggccagcaaggcccaagctattgctgatgacgcccagaaggatctggatgag
gccctgccggccctggacgcagccctggccagccttcgaaacctcaacaagaatgatgtg
acagaggtgcgtgccatgcagcgcccacccccgggagtgaagctggtcatagaggccgtg
tgcatcatgaagggcatcaagcccaagaaggtacccggagagaaaccaggctccaaagtg
gatgactactgggagcccggcaaggggctgctgcaagacccaggccgcttccttgaaagc
ctcttcaagtttgacaaggacaacattggggaagcagttatcaaagccatccagccatac
atcgacaacgaggagttccaaccggccgccattgccaaggtgtccaaggcctgcacgtcc
atctgccagtgggtgcgcgccatgcacaagtaccactttgtagccaaggctgtggagccc
aaacggcaagccttgcgagaagcccaggacgacctggaagtcacccagaggatactagag
gaggcaaagcaccacctgcgcgaagtggaagatggcatctccacgctgcaggccaagtat
cgagagtgcgtgaccaagaaggaggagctggagatgaagtgtgagcagtgtgagcagcgc
ctaggccgggccgacaagctcatcaacgggctagcagacgaaaaggttcgctggcaggac
actgtggagaatctggagaatatgcttgacaacatttttggcgatgtgctggtggctgct
ggctttgtggcctacctggggcccttcacggggcagtaccgtgcagcgctctatgagtac
tgggtcaaccagctcacagtttacggtgtcccacacacctccaagcccacgctgatttca
accctgggaaaccccgtgaagatccgctcttggcagattgctggcctccccaatgacact
ctgtcagtggagaatggggtcatcaatcaattctcccagcgctggacccacttcattgac
cctcagggtcaggctaacaaatggatcaagaacatggagaaggagagtgggctagatgtg
ttcaagctgagtgaccgcgacttcctgcgcagcatggaaaacgctatccgctttggcaag
ccttgccttctggaaaatgtgggtgaggagctggatcccgcactggagcccgtgttgctt
aagcagacgtacaagcagcaagggaacacagtcctgaagttgggagacacagtgatcccc
taccatgaggacttcaggatgtacattaccaccaagctgcccaaccctcactattcacca
gaggtctccaccaaactcaccctcatcaactttacactgtcacccagtggcctagaggac
cagctactgggccaggtagtggccgaggaacggcctgatctggaagaggccaagaaccag
ctgattatcagtaatgccaagatgcggcaggagctaaaggacattgaggaccagatcctg
taccgcctcagctcctccgagggtaaccctgtggacgacgtggagcttatcaaggtgctg
gaggcttccaagatgaaggctgctgagatccaggctaaggtcaggattgcagagcagaca
gagaaggacattgacctcacgcgcatggagtacatacctgtggctgtccgcacccagatc
ctcttcttctgtgtgtcagacctggccaacgtggaccccatgtaccagtactctcttgag
tggttcctcaacatcttcctctcgggcatcgccaactcagagagagcagacaacctgaag
aagcgcatcgtcaacatcaaccgctacctaaccttcagcctctacagcaatgtctgccgc
agcctctttgagaagcacaagctgatgttcgccttcctgctgtgcgtccgtattatgatg
aatgagggcaagatcaaccagggtgagtggcgctaccttttgtctggaggctccatccag
accatgtctgagaaccctgccccacattggctctcagaccgggcctggagagacatcttg
gcactctcaaacctgccagccttttctaccttctctaccgacttcgtgcagcacctcccg
aaattccaggccatctttgacagtgctgagcctcacagggagcccttgcctggcatctgg
aacacatacctggacgagttccagaaactgcttattctccgttgcctgcgtggggataaa
gttactaatgccatgcaggactttgtggccaaccacctggaaccccgattcattgagccc
cagacagccaatctgtctgcagtgttcaaggagtccaactccacaacacccctcatcttt
gtgctgtcacctggtactgaccctgctgctgacctctataaatttgcagaagaaatgaag
ttttccaagaagctctctgccatctctttgggacagggtcagggccctcgggctgaagcc
atgatgcgcaactccatagagaggggcaagtgggtcttctttcagaactgccacttggca
ccaagctggatgccagccctggagcgtctcatcgagcacatcaatcctgacaaggtacac
cgggacttccgcttatggctcaccagcttgcccagtaataagttcccagtgtccatccta
caaaatggctccaaaatgactattgaaccgccacgtggcgtcaaagccaatctattgaag
tcctacaacagcctcagtgatgacttcctccactcctgtcaaaaggttgtggagttcaag
tccctgctgctatctctgtgtctgttccacggcaacgcacttgagcgccgtaagtttggg
cccctgggtttcaacatcccctatgagttcacagatggagacctgcgcatctgcatcagt
cagctcaagatgttcctagatgaatatgaggatatcccctacaaggttctcaagtacaca
gctggagagatcaactatggtggtcgcgtcactgacgactgggaccgacgctgtgtcatg
aacatactagaagacttctacaaccctgctgtgctctctccggagcacaggtacagcaaa
tccggcatataccaccagatcccacccacctatgacctcaatggctacctctcctacatc
aagagccttccactcaatgacatgcctgagatcttcggtctgcatgacaacgccaacatc
acctttgcccagaacgagacgtttgccttatttggtgccattctccagctgcagcccaaa
tcctcctccatgggtggccagagccgggaggagttagtggaagacgtggctgaggacatc
ctggtccaggtgcccaaacctgttgacctggaggaggtggtaaacaagtaccctgtactg
tatgaggagtcaatgaacacggtgctggtgcaagaggtcattaggtacaacaagctccta
atggtgatcacacagacactcagtgacatgctcaaggcaataaaggggctagtggtaatg
tccctggagctagagctgatgtccaccagcctgtacaacaacgctgtgcctgagctctgg
aaaagcaaggcctacccgtcgctcaagccactggcttcctggatcatggacctgctgcag
cgcctgaatttcctgcattcctggatcaaaaatggcatcccatctgtcttctggatcagt
ggcttcttcttccctcaggctttcctgacaggcactctacaaaactttgcccgaaagttc
gtcatctctatcgacactatcacctttgatttcaaggtactgtcctacgcatcatcagag
attgcggaaaggcccagtacggggtgctatatctacggactgttcctggaaggcgctcgc
tgggacccgttcgatttccagctggctgagtcccggcccaaagagctgtacacagagatg
gctgttatctggcttttgccagtagctaaccgaaaggtccagaaccaggacttctacctg
tgccccatctacaagactctgacccgtgctggaacattatcgactacaggccactcaacc
aactacgtcattgctgtagagatccccagcaaccagcctcagcgacactggataaagcgt
ggtgtagctctcatctgtgccctggactactag

KEGG   Rattus norvegicus (rat): 207117
Entry
207117            CDS       T01003                                 

Gene name
Dnah8
Definition
(RefSeq) dynein heavy chain 8, axonemal isoform X1
  KO
K10408  dynein heavy chain, axonemal
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    207117 (Dnah8)
   05016 Huntington disease
    207117 (Dnah8)
   05022 Pathways of neurodegeneration - multiple diseases
    207117 (Dnah8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    207117 (Dnah8)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     207117 (Dnah8)
SSDB
Motif
Pfam: DHC_N1 AAA_6 DHC_N2 Dynein_C AAA_8 AAA_9 AAA_7 AAA_lid_11 MT Dynein_heavy AAA_5 Dynein_AAA_lid AAA_lid_1 AAA_16 AAA_18 AAA_33 TusA DUF2540 DAHL
Other DBs
NCBI-GeneID: 207117
NCBI-ProteinID: XP_038955254
RGD: 619986
Ensembl: ENSRNOG00000000542
Position
20
AA seq 4727 aa
MESEEDNTAPPPLSEEEAPPPPPSEDTAPPAEQAPPPEDGAPPPTGDGVEPSAEGEALQA
EGIDPASLSVQEDPALNMTDYRSLIPSDEEITMPPEDDESGQGRVRARLAPRPVQSVLSD
GLSQSSRRSSKFRRSMTGIPNLQETLKEKQARFREAREGRRMKIDPSYKYIFEILGEKLG
LDLVSVEELILDCPSLDAFSSFFEKGGSKTLKFLYQEGDVPGLECGRTITGVPKGGKMMR
LYIDNAAPEKLKELCLFFVRCRNDVAINSKTIYEDVLFTVLDASKGLLKGIKNMLKNIFL
PAILATGNWGALNQSKQGESEKHIFTETINRYLLFLDGATISIEGTVMLKKVDNIDFSKL
HTFEEVTAAASSSEMVHQLEDVLMMWYKQIEQVLIESEQMRKEADDSGPLTELEHWKRMS
AKFNYIIEQIKGPSCKAVINVLNVAHSKLLKNWRDLDARITDTANESKDNVRYLYTLEKV
CQPLYNYDLVSMAHGIQNLINAIRMIHSVSRYYNTSERMTSLFIKVTNQMVTACKAYITD
GGTNHVWDQETPAVLKKIQDCIFLFKEYQASFHKTRKQILESSGEKSFEVSEMYIFGKFE
AFCKRLEKITEMITIVQTYSALSNSTIEGIDILGIKFKNIYQGIKKNQYDILDPRRTEFD
TDFSDFMGKINTLEIQIQAFMNITFGKILSSQQALQLLQRFQKLNMPCLQLEINHTIERI
LQCYVAELEATKKLYHSQKDDPPLARNMPPIAGKILWVRQLYRRINEPINYFFKNSDILS
SIEGKAVIRQYNKISYVLVEFEVVYHTAWVKEISQLQYALQATLFVRHPETGKLLVNFDP
KILEVVRETKCMIKMKLDVPEQAKKLLKLESKLKADKLYLQGLLQYYDDLCQEVPSVFVN
LMTPKMKKVESVLRQGLTVLTWSSLMLESFFKEVESVLDMFNQLLKKVNDLCEMHIDTVL
KEIAKTLLISLSDSGATRVEDMLTLNETYTKEWADILNHKSRHVEEAVKELILIFEQIYE
VKYTGKPAKPVPEQRKHVVFGSEADEGESLEYDPDSTARDVDNNDKEDEFKKECKEVYAF
FSHQLLDSLQKATRLSLDTMKKRIFVGNQGRKRSEDVVSFIKTEVHLAIPNVVMVPSLDD
IQQAINRMIQLTLEVSRGVAHWGQQQVRRTKSPQTSSRGSDQPSIMGKALKKEERSFEES
IPARKLKNFYPGVAEHKDISKLVLLLSSSVNSLRKAATEALQDFQKYKTLWTEDRDVKVK
EFLANNPSLTEIRSEILHYATFEQEIEELKPIIDVGALELHTEPMKLALSIEAKAWKMLL
CRYLNEEYKKKMSDMIVFINEYLKKLSRPIRDLDDVRFAMEALSCIRDNEIQMDMTLGPI
EEAYGILNRFEVEVTKEESEGVDTLRYSFNKLQSKAVSVQDELVQVQPKFKSSLLESVDV
FREDVINFTEAYETEGPMVPNIPPQEASNRLQIFQANFDDLWRKFVTYSAGEQLFGLPVT
DYEVLHKTRKELNLLQKLYGLYDTVMGSISGYYEILWGDVDIEKINAELLEFQNRCRKLP
KGLKDWQAYLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDTFCLR
NIMEAPLLKNKDDIEDICISAIKEKDIEAKMTQVIENWTNQNLSFSAFKGKGELLLKGTE
SGEIITLMEDSLMVLGSLLSNRYNTPFKKTIQNWVYKLSTSSDIIEEWLVVQNLWVYLEA
VFVGGDIAKQLPQEAKRFQNIDKSWVKIMQRAHENPNVISCCVGDETMGQLLPHLHEQLE
VCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHPK
DYDRMTAVISREGEKIMLDTPVMAKGPVEIWLLDLLKVQMSSLHNIIRSAFYQISDSGFL
LLPFLNHFPAQVGLLGIQMLWTHDSEEALNSAKDDRKIMHITNQKFLDILNTLISQTTHD
LTKFDRVKFETLITIHVHQRDIFDDLVKMHIKSVTDFEWLKQSRFYFKEDLDQTVVSITD
VDFNYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCL
GKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARK
ERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRV
KLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSE
LSTVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSNTYAELQAAVDNQVNLEGLIN
HPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKSLTECGRPHREMRMNPKAIT
APQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNK
TLTLANGDRIPMAPTCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKRRT
QQEATAFLSLYDKVFEDAYTYMKLNLIPKMQLLECNYITQSLNLLEGLIPSKEEGGVSSV
DHLHKLFVFGLMWSLGALLELESREKLEVFLRGHESKLNLPEIAKDSHHTMYEFYVTDYG
DWEHWNKRLQPYFYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKT
VMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRMGSTYGPPGGRKMTVFID
DINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIP
QRLKRQFTVFNCTLPSNTSIDKIFGIIGCGYFDPCRKFRPEICDMIGNLVSVGRVLWQWT
KVKMLPTPSKFHYIFNLRDLSRIWQGMLTIKAEECKTIPILMALFKHECNRVIADRFITP
DDEQWFNTQLIRAVEENISPEVAASINPEPYFVDFLRDMPEPTGDEPEDTMFEVPKIYEL
VPSFEFLCEKLQFYQKQFNEIIRGTSLDLVFFKDAMTHLIKISRIIRTSCGNALLVGVGG
SGKQSLSRLASFIAGYQIFQITLTRSYNVSNLIDDLKNLYKVAGADGKGITFIFTDNEIK
DEAFLEYLNNLLSSGEISNLFARDELDEITQGLISVMKRELPRHPPTFDNLYEYFISRSR
RNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPKEALIAVASYFLSDYNIVCSM
EIKRHVVEAMGLFHDMVSESCENYFQRYRRRAHVTPKSYLSFINGYKNIYTEKVKYINEQ
AERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASVKADEVLAEVTVSAQASAKVKNEV
QEVKDKAQKIVDEIDSEKVKAESKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLI
MRIMDCVLLLFQKKIDPVTMDPEKPCCKPSWGESLKLMSATGFLFSLQQFPKDTINEETV
ELLQPYFNMDDYTYESAKKVCGNVAGLLSWTLAMAIFYGINREVLPLKANLAKQEGRLAV
ANAELGKAQALLDEKQAELDKVQAKFDAAMNEKMDLLNDADMCRKKMQAASTLIDGLSGE
KVRWTQQSKEFKAQINRLVGDVLLCTGFLSYLGPFNQIFRNYLLKDQWELEMKARKIPFT
ENLNLIAMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKE
KENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIREELDPALDNVLEKNFIKSGTAFKVK
VGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQE
LESERVKLLEDVTFNKRKMKELEDNLLYKLSTTQGSLVDDESLIGVLRITKQTAAEVSEK
LHVAAETEIKINTAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARS
EKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFALLMTLKIDLQRGTVKHKEFQAL
IKGGAALDLKACPPKPFRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKNWFDKDAP
EEEIIPDGYNDSLDTCRKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEE
SDTHTPLICFLSMGSDPTIQIDALAKKLKLECRTISMGQGQEVHARKLVQLSMQQGGWVL
LQNCHLGLEFMEELLETLMVTETTEDSFRVWITTEPHDRFPITLLQTSLKFTNEPPQGVR
AGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFS
ASVQFIQNHLDECDIKKGVSWSTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFE
PSFCFYTGYKIPVCKTLDQYFEYIQSLPSLDNPEVFGLHPNADITYQSNTASDVLETITN
IQPKESGGGMGETREAIVYRLSEDMLSKLPPNYVAHEVKARLMKMGHLNSMNIFLRQEID
RMQRVISLLRNSLNDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWF
TELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVTIHNEVL
RQTKEEIITPPVEGVYIYGLYMDGASWDRRNGKLTESTPKVLFMQLPVLHIYAINSTAPK
DPKLYVCPIYKKPRRTDLTFITVVYLRTVLSPDHWILRGVALLCDIK
NT seq 14184 nt   +upstreamnt  +downstreamnt
atggagtctgaggaagacaacacagccccacctcctctgagtgaagaggaagctccgccc
cctcccccttcagaagacactgcccctcccgcggagcaggccccgccccctgaggatggt
gccccgccccccacaggagatggcgtcgaacccagtgctgaaggagaagctctgcaggct
gagggcatagaccccgcgtccctgtctgtgcaggaggatcctgctcttaacatgacggac
tataggagtctgattccctcagatgaggagataacaatgccgccggaggatgacgagtct
ggccagggcagggtccgggcgaggctcgcccctaggcctgtacaatcagtgttgtccgat
gggctttctcagtcttcccggcggtcctccaagttccgccgaagtatgaccggcattcca
aacctccaggagaccctcaaagagaaacaggcacgatttagagaagcaagggaaggccgg
agaatgaaaattgacccctcatataaatacatatttgaaattctaggagaaaagcttgga
ctggatttagtatctgtggaagaactaattttggattgcccatcgctggacgccttctcc
agtttttttgagaaaggcggctctaagacactgaagtttttgtaccaggaaggagatgtg
cctggtttggaatgtggtcggacaattaccggcgtccccaaaggggggaaaatgatgaga
ctgtacatagacaacgcagcccccgaaaaactgaaggaactgtgcttatttttcgtccgc
tgtcggaatgacgttgccatcaattctaaaaccatttacgaggatgtgctgtttactgtc
ttggatgcgtccaaaggactcttaaaaggaatcaagaacatgctgaaaaacatatttcta
cccgctatccttgccacgggcaactggggtgccttaaaccagtctaagcagggcgaatcc
gagaaacatattttcacagaaaccatcaacagatatcttttgtttctggatggtgccacc
atcagcatcgaggggacagtgatgttgaagaaggtggacaatatcgatttctccaagctg
cacacctttgaagaggtcacagcggcagcgagcagttcagagatggtgcatcagctggag
gacgtcctgatgatgtggtacaagcagatcgagcaggtccttattgagagtgagcagatg
agaaaagaagctgatgattccggcccactcaccgaattggagcactggaagcgcatgtcg
gccaagttcaactacatcattgagcagatcaaagggcccagttgtaaggccgtcataaat
gtgctaaacgtcgcacactccaagttgttaaagaactggcgggatttggatgcgcgaatc
acggacacggcaaatgaatcgaaggacaacgtgcgctacttgtacaccctggagaaagta
tgtcagcccctctacaactacgacctggtctccatggcacacggcatacaaaacttgatt
aatgccatcaggatgattcacagcgtgtcgaggtattataatacatcagagaggatgacg
tcattgttcatcaaggtaaccaatcagatggtgacagcctgtaaagcatacattactgac
gggggaacaaaccacgtgtgggaccaggaaacgccagccgtcctaaaaaagatccaggat
tgcatctttctcttcaaggagtaccaggcatcctttcacaaaacaaggaagcagatttta
gaatcctcaggggagaagtcttttgaggtttccgaaatgtatatatttggaaaatttgaa
gccttctgtaagagactggagaagatcacggagatgataaccatcgtgcaaacatactcg
gccttgagcaactctacgatcgaagggatcgatattttggggatcaagtttaaaaacatt
taccaggggatcaagaagaaccaatatgacatcctggacccgcgaagaacagaatttgac
acagacttctcagattttatggggaaaatcaacacgttagagattcaaatacaggcattt
atgaacattacctttggaaagatcttgtcctcccagcaggcgcttcagctgctccagagg
tttcagaagctgaacatgccctgccttcagctggaaatcaatcacaccattgagcggatt
cttcagtgttatgtggctgaacttgaagctaccaagaagctctatcattctcagaaggat
gacccccctctcgctcgcaacatgccccccatagcaggaaaaattctctgggtgaggcag
ctgtaccgccggataaatgaacccatcaactatttctttaaaaactcagacatcttgtca
agcatagaaggtaaagctgtcatacgtcagtataacaagatctcgtacgtgctggtggaa
ttcgaggtggtttaccacaccgcgtgggtcaaggagatctcccagcttcagtacgctttg
caagctacactgtttgtgcgacatccggaaacggggaagttgctggttaactttgaccct
aagattttggaagtcgtgcgggaaacaaagtgcatgataaagatgaagctagatgttccg
gaacaggcaaagaagttgctgaaactagaaagcaaactgaaggcagacaagctgtatctg
cagggccttctgcagtattacgatgatttgtgccaggaagtgccttctgtgttcgtcaat
ctgatgaccccgaagatgaagaaggtggagtccgtcctgaggcaagggctcacagtactg
acctggtcctcactaatgctggagagcttcttcaaagaggttgagtccgttttggatatg
ttcaaccagcttttaaagaaggtcaatgacctgtgtgaaatgcatatcgacacagttctg
aaggagatcgccaagacattattgatctccttgtcggacagtggcgccaccagagtagag
gacatgctgaccctcaacgagacgtacaccaaagagtgggctgatattctaaaccacaag
agcaggcatgtggaagaagccgtgaaggagctgatattaatatttgaacaaatctatgaa
gttaaatacactggaaaaccagccaaaccagtgccagagcagaggaagcatgttgttttt
ggaagtgaggcagatgagggcgaaagcctcgaatacgacccggactcgacggcgagggac
gttgacaacaatgataaagaagatgaatttaaaaaggagtgcaaggaagtctacgctttc
ttctcgcatcaattgctggacagtctacagaaggcaacacgcttatctttggacacaatg
aaaaagagaatctttgttggaaaccaagggagaaagcggtcagaggacgtcgtttccttc
ataaaaaccgaagtgcacctggcaatccctaacgtggtgatggttcccagcctggatgac
attcagcaagccatcaaccgcatgatccagttgaccctggaggtgagcagaggagtggca
cactggggacagcagcaggtcaggcggacaaagtctccccagaccagttctcgaggctcc
gaccaaccctcgatcatggggaaagcactgaagaaggaagagaggtcgtttgaagaaagc
atcccagccaggaagctgaagaacttctaccctggcgtggcggagcacaaggatatctcc
aagctggtcctcctcctgtcgtcctctgtgaattccctccggaaggcggccactgaggcc
ctgcaggactttcagaagtacaagactctctggacggaagacagagatgtgaaagtcaag
gagtttttggccaacaacccttccctgactgagatccgatcagaaattctccactatgca
acctttgagcaggagatcgaggaactgaagcccattattgatgtaggagccttggagctg
cacacagagccaatgaagttagccttgtccatcgaggccaaggcgtggaagatgttgctc
tgccgctacctaaatgaggaatataagaagaaaatgtcagacatgatagtgtttatcaac
gaatacttgaaaaagttatccagacccatccgggacttagacgatgtcaggttcgccatg
gaggctttgtcctgtatccgagataatgaaattcaaatggacatgaccttggggcccata
gaagaggcctacggcattttgaacagattcgaggtggaagtgaccaaggaggagtcagaa
ggcgtcgacaccctgagatactcgttcaacaagttgcagagcaaagcggtttccgtgcaa
gatgaacttgtgcaagtgcaaccgaaattcaaaagcagcctgcttgagtcggtggatgtc
ttccgggaggacgttataaacttcacagaagcctatgagacggaaggacccatggtacca
aatattccaccccaagaggctagcaacaggctgcagatattccaggccaatttcgatgat
ctatggaggaaatttgtcacatattcagccggggaacaactttttggattacccgtgact
gactatgaggtcttacacaagactagaaaagagctcaacttgcttcagaagctgtatggc
ttgtacgacaccgtcatgggcagcatcagtggctattatgagatcctctggggagatgtg
gacattgaaaagatcaatgccgagctgctagaattccagaacagatgtcgaaaacttccc
aaaggactcaaagactggcaggcgtatctggacctcaaaaaaaggatcgacgacttcagt
gagtcgtgtccgctcctggaaatgatgaccaacaaggcaatgaagcagaggcattgggac
cgcatctcggagctcaccggcaccccgttcgacgtggagtccgatacgttctgtctgaga
aatatcatggaagcgccactcctgaagaacaaggacgatattgaagacatctgcatatcc
gccattaaggagaaggacattgaagccaagatgactcaggtgattgagaactggaccaac
caaaacctgagtttttcagcgtttaagggcaaaggcgagctcctgctcaaaggaaccgag
tctggagagattatcaccttgatggaggatagcttgatggtcctaggttccttgctaagc
aacagatataataccccgtttaagaaaactatccagaattgggtctataaactgtccacc
tcttcggatatcatagaagagtggctggtggtccagaacctgtgggtctaccttgaagcc
gtctttgtgggtggcgacattgccaaacagctgccccaggaagccaaacgtttccagaat
atcgacaagtcgtgggtaaaaatcatgcagcgagctcacgagaaccccaacgtgatcagc
tgctgtgtgggggatgagaccatggggcagctcctgcctcatttgcacgagcagttggag
gtctgtcagaagtccctcacagggtatctggaaaagaaacgactgctgtttccaagattc
ttctttgtctccgatcccgttctgctggaaatccttggacaggccagcgactcccatacc
attcagccacacctccctgcagtgtctgacaacatcaatgaggtgacatttcatcctaaa
gactatgatcggatgacggccgttatatcgagagaaggagaaaaaatcatgctggatact
cctgttatggccaaaggcccggtagagatttggcttctcgacttgttaaaagtacagatg
tcgtcattacataatataatccggtcagccttctaccagatcagcgattcgggctttctc
cttttacctttcctgaaccacttccctgctcaggttgggcttctgggcattcaaatgctg
tggacacatgattcagaagaggctttgaatagcgcaaaagatgacaggaaaatcatgcac
ataaccaaccagaagtttctggacattctaaacactctgattagccagacgacgcatgac
ctgaccaagtttgacagagtgaagtttgaaaccttgatcacaatccacgtgcaccagaga
gatatctttgatgacttggtaaaaatgcacatcaagtcagtgactgactttgagtggttg
aagcagagcagattttatttcaaagaggatctggatcagaccgtggtgtccatcacagat
gttgacttcaactaccaaaatgaatttctgggatgcacggatcgcctcgtgatcaccccg
ttaacagatagatgctacatcacgctggctcaggcgcttggaatgaacatgggcggtgct
ccagcaggacccgccgggacgggtaaaacggaaaccacaaaagacatgggcaggtgtttg
ggcaagtatgtggttgtgttcaactgctccgaccagatggatttccgaggcctagggagg
attttcaaaggccttgcccagtccggttcctggggttgctttgatgagttcaacagaatt
gaattgcctgttttatctgtggcggcccaacaaatttacatagttctgacagcgaggaaa
gagaggaaaaaacagttcatcttctcagacggcgattgcgtggacttaaatccagaattc
ggaatcttcctaaccatgaaccccggatacgctgggcgccaggaactgcccgaaaactta
aaaatccagtttagaacagttgcgatgatggttcctgataggcagatcatcatgcgagtt
aagctggcaagctgtggcttccttgaaaatgttatcttggcgcaaaagttttacgttctc
tataaactctgcgaagagcagctcacgaaacaggtccactatgacttcggactgagaaat
atcctgtctgtattgaggacccttggatctcagaaaagagcacggccagaagacagtgag
ctaagcacggtcatgagaggactacgagacatgaacctttccaaactggttgatgaagat
gagcccttgttcctcagcttgatcaacgacctgtttccgggtttacaactggacagcaat
acttatgcggaactgcaggccgcggtggacaaccaggttaacctagaaggtctgattaac
cacccaccctggaatctcaaattagtgcagttatatgagacctctctggtacggcacggc
ctgatgaccctcgggcccagtggttccgggaagacgacggtcataacaattctgatgaag
tcattaacggagtgcgggaggccccacagagagatgcgaatgaacccaaaggcgattacc
gcgcctcagatgttcggccggctggacacagccaccaacgactggacagatgggatcttc
tccaccctgtggaggaagacattaaaagctaaaaagggtgaaaacatcttcctcatctta
gatggccccgtggatgccatttggatcgaaaacctaaactctgtgctagacgacaacaag
acactcaccctggccaatggggaccgcattcccatggccccgacctgtaagctgctgttt
gaggtgcacaacattgagaacgcgtcccccgccacggtgtcgaggatgggtatggtgtac
atcagcagttcggctctcagctggaggccgatattacaggcatggctgaagaggcgtacc
cagcaggaagccactgccttcttgagtctgtacgacaaggtgtttgaagacgcgtacaca
tacatgaaactcaacctcatccccaagatgcagctcctggagtgtaattacatcacgcag
tctctcaatctcctggaaggtttaatcccttccaaagaagaaggtggtgtctcctccgtg
gaccatctccacaagctgttcgtgtttggcctgatgtggagtttgggagccctcctggaa
ctggagagcagagaaaaactggaagtcttcctgcgaggtcatgagagcaagttaaacctg
ccggaaatagccaaggactcccaccacaccatgtatgagttttacgttaccgactacggt
gactgggaacattggaacaagagacttcagccatacttctatccgacggacagcattccg
gagtactcatccatcttggttccaaatgtggacaacatcaggaccaatttcttgatagac
accatcgcgaaacaacataaagcggttttgctcacgggagagcaggggacggcgaaaacg
gtaatggtgaaggcttatctgaagaaatatgaccccgaagtgcagctctccaagagtctg
aatttttcctccgctacggagcctatgatgttccagagaacgatcgaaagctacgtggat
aaaaggatggggagcacctacgggcccccaggagggaggaagatgaccgtgtttattgac
gatatcaatatgcctgtcatcaatgagtggggagatcagatcaccaacgagatcgtgcgt
cagatgatggagatggagggaatgtacagcctggacaaacccggagacttcaccaccatt
gtggacgtgcagctcatagctgccatgattcaccccggaggggggcggaacgacatccca
cagcgcttaaaaagacagttcactgtgttcaactgcacgctgccctccaatacgtctatc
gacaaaatctttggaattatcggctgtgggtacttcgacccgtgtagaaagttcaggccc
gagatctgtgacatgattggaaatttggtgtcagtcggccgagtgctgtggcagtggacc
aaggtgaagatgctccccacgccttctaagtttcattacatcttcaacctccgggacctc
tccagaatctggcaggggatgttaacgattaaagctgaagagtgcaaaaccatccccatt
ctcatggctctcttcaagcacgagtgtaacagagtgatcgcggacaggtttataactccg
gatgatgaacagtggttcaacacacagctcatccgggcggtggaagaaaacatcagcccg
gaggtcgcagcgagtatcaaccctgaaccgtactttgtggattttctccgtgacatgccg
gagcccactggcgatgaacccgaagacactatgtttgaagtgcccaagatctacgaattg
gtgccctccttcgaatttctgtgtgagaagctccagttttaccagaagcagttcaacgag
atcatcagagggacgtctctggacctcgtgttttttaaagatgccatgactcacctcatt
aagatatctcggatcatccggacgtcctgtgggaacgcattgctggtgggtgttggcggc
tcaggaaagcagagcctttcaaggctggcctcttttattgctgggtaccagatatttcag
ataacattaactaggtcttacaacgtgagcaacctaatagatgacctaaagaatttgtac
aaagttgccggcgcggacggcaaaggcatcaccttcatcttcacggacaatgagataaaa
gacgaggcattcctggaataccttaacaatctgctgtcctcaggggagatctccaattta
tttgcccgagacgagttggatgaaatcacccaaggcctgatatcggtgatgaagagggag
ctgcctcgacaccctcccacctttgacaacttgtatgaatacttcatcagcaggtccagg
aggaatctgcatgttgttctttgcttttccccagttggtgagaagttccgggcacggtcc
ctcaagtttcctggcttgatttcaggctgcaccatggactggttcagtcgctggcccaag
gaggctctgatcgccgtggcctcatacttcctttcagattataacattgtctgctccatg
gagattaagaggcacgttgtggaagccatggggctctttcatgacatggtttctgagagc
tgcgaaaattatttccaaagataccgccgaagagcccacgtgactcccaaatcctatctc
tcatttataaatggttataaaaacatctacactgaaaaggtgaaatatatcaacgaacaa
gcggaacggatgaatatcggtctcgacaagctgatggaggcgagcgaatctgtcgctaaa
ctctcccaggacctggcggtgaaggagaaggaactggctgtggcttccgtgaaagcagat
gaagtcctggcagaggtcacagtgagtgcccaggcttcagccaaagtgaaaaacgaagtc
caggaggtaaaagataaagctcagaaaattgtggatgaaatcgacagcgagaaggtgaaa
gcggagtctaagctggaggccgccaaacctgcgctggaagaagcagaagcagccctgaat
accatcaaaccaaatgacattgccacagtcaggaagctggccaaaccaccacatctgatc
atgagaatcatggactgtgtgctgttgctattccaaaagaaaatcgaccccgtcactatg
gacccggaaaagccttgctgcaaaccatcctggggggagtcactaaagctgatgagtgcc
acagggttcctgtttagcctgcagcagttccccaaggacacaatcaacgaagagaccgta
gagctgctgcagccatattttaacatggacgactacacttatgaaagcgccaagaaagtc
tgtggcaacgtggccgggctgctgtcctggacacttgccatggcaatattttatgggatc
aacagggaagtcctgcccctgaaggcaaacctggccaagcaggaaggccggttggctgtg
gccaatgcggaattagggaaggcccaggcgctgctggacgagaagcaggctgagctggat
aaagtgcaggccaaatttgacgccgcgatgaacgagaaaatggacctgctcaatgatgcc
gacatgtgcaggaagaagatgcaggcagcctccacgctcattgatgggctgagtggagag
aaagtccggtggacacagcaaagcaaggagttcaaggcgcagattaacagactcgtaggc
gatgttctgctatgcacaggcttcctctcctacctcggccccttcaatcagatatttagg
aactatttgcttaaagaccagtgggagttagagatgaaagcgcggaaaatccctttcacc
gaaaacctgaatcttattgcgatgttggtggaccctcccacaattggcgagtggggcctg
cagggactccctggagatgacttgtcaattcagaatggcattattgtgacaaaggctacc
agataccctctgcttattgatccccagacccaggggaaaacgtggattaaatcgaaggag
aaagaaaacgacttgcaggtgacatctctgaaccacaagtatttccgcacgcacttggag
gacagcctctcgctgggtcgtccccttctcatcgaggacattcgagaggagctggacccg
gctctggataacgtgctggagaagaacttcatcaaatcaggcaccgctttcaaggtaaaa
gtgggtgataaggaatgtgacatcatggacacgtttaaactttacatcaccacgaagtta
ccgaaccccgccttcacccctgagatcaacgccaagacgtccgtcatcgatttcaccgtc
accatgaagggacttgagaaccagttactcaggagggttattctcacagagaaacaggag
ctggagtcggagagggttaagctcctggaggacgtgactttcaataagaggaagatgaaa
gagctggaggacaatctgctgtacaaactgagtaccacacaaggttccctggtggacgac
gaatctctcatcggcgtcctgcgcatcaccaaacagacagctgcggaagtgagtgaaaag
ctccacgtggcggcggaaacggagatcaagatcaacacagctcaggaggagttccggcct
gcggccacgcgaggcagcatcctttacttcctcatcacagagatgagcatggtcaacatc
atgtaccaaacctcactggcccagttcctgaagctgtttgaccagtctatggccagatcc
gaaaagtctccgctccctcaaaaaagaattacaaatatcatcgagtacctgacgtacgag
gttttcacctactcagtgagaggcctgtatgaaaaccacaagttcctcttcgctctcctc
atgacactgaagatcgatctccagagggggacagtgaagcacaaagagtttcaggctctg
attaaaggtggagcagccctggacctgaaggcgtgcccccccaagcccttccgctggatc
ctggacatgacgtggctgaaccttgtggagctcagtaagctcccgcagtttgcagaaatt
atgaaccagatatctcggaatgagaaggggtggaaaaactggtttgataaggacgcccca
gaggaggagatcatccccgatggatacaatgattctttggacacctgccgcaagcttctg
cttatcagatcgtggtgcccagaccgcactgttttccaagcgagaaagtacatcgccgac
tctctcgaggagaagtacacggagccggttatcctaaacctggagaagacctgggaggaa
agtgacacacacacgcctctgatctgtttcctgtccatgggctccgatcccaccatccag
atcgacgcgttggccaagaaactgaagctggaatgcagaactatctcaatgggacaagga
caagaagttcatgcccgaaagctggtccagctgtccatgcaacagggcggttgggtatta
ctacagaattgtcaccttggtctagaattcatggaagagttactagagacgttgatggtc
acggaaaccactgaggactccttcagagtgtggataaccactgagccccacgaccggttt
ccaatcacattgctccagacttctctcaagttcacaaatgagccaccccaaggcgtccgg
gcaggcctgaaaaggacatttgctgggatcaaccaagacctcctggacatcagtaacttg
cccatgtggaagcccatgctgtacacagtggcatttctgcactccactgtgcaggagcga
cgaaaattcggacccttgggatggaacattccctatgaattcaattctgccgacttctcg
gccagcgttcaattcatccagaaccacctcgatgagtgcgatattaaaaagggagtgtca
tggagtacggttcggtacatgatcggagaagtgcagtacggtggcagagtgacagacgac
ttcgacaagcggctgcttaactgctttgcccgggtctggttcagtgagaagatgtttgag
ccctcgttctgtttttacaccggctataaaatccccgtgtgcaaaaccttggaccagtat
tttgagtacatccagtctctgccatccctagataaccctgaagtctttgggctccaccct
aacgctgacatcacgtatcagagtaacacggcttccgatgttctcgaaaccatcactaac
atccagccgaaagagagcggcggcggcatgggcgagactcgagaggccattgtctacagg
ctgtctgaggacatgctcagcaagctgccccctaactatgtggctcatgaggtgaaagcc
cgtttgatgaagatgggacaccttaattccatgaacatattccttagacaggagatcgac
aggatgcagagggtcatctcgctcctccggaatagtctgaatgacctgaagctggctatc
gaaggaacaatcatcatgagtgagaacttgagagatgcgttggacaacatgtatgatgct
cgcatacctcagctctggaagagagtgtcctgggactcctccaccctgggcttctggttc
accgaacttctggaaaggaacgctcagttctcaacgtggatattcgagggaaggcctaac
gtattctggatgaccgggttctttaacccccaaggtttcctcacagcaatgaggcaagaa
gtaacccgagctcacaaaggctgggcgctggactccgtgaccatccacaatgaagtccta
cgacagaccaaggaagagatcataacgcccccggtggaaggcgtgtatatttatgggctg
tatatggatggagcatcctgggacaggcggaacgggaagctcacagaatccaccccgaag
gttctcttcatgcagcttccggttctgcatatctatgccattaactccacggcgcccaag
gatccgaagctgtacgtgtgtcctatctacaagaaacccaggcgaaccgacctcaccttc
atcaccgtggtgtacctgcgaacggtgctgtccccagatcactggatcctgagaggggtg
gccctcttgtgtgacatcaaataa

KEGG   Rattus norvegicus (rat): 252893
Entry
252893            CDS       T01003                                 

Gene name
Dnah7
Definition
(RefSeq) dynein heavy chain 7, axonemal isoform X1
  KO
K10408  dynein heavy chain, axonemal
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    252893 (Dnah7)
   05016 Huntington disease
    252893 (Dnah7)
   05022 Pathways of neurodegeneration - multiple diseases
    252893 (Dnah7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    252893 (Dnah7)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     252893 (Dnah7)
SSDB
Motif
Pfam: AAA_6 DHC_N2 Dynein_C AAA_8 AAA_9 AAA_7 AAA_lid_11 MT Dynein_heavy Dynein_AAA_lid AAA_5 AAA_lid_1 T2SSE EF-hand_7 AAA_18 EF-hand_6 EF-hand_8 EF-hand_1
Other DBs
NCBI-GeneID: 252893
NCBI-ProteinID: XP_038940497
RGD: 621798
Ensembl: ENSRNOG00000052194 ENSRNOG00000060984
Position
9
AA seq 4023 aa
MSSEQDKLSTKEKSKTPVRFLPQLAMDKPSSKEKAKTPTRALPQLTLTGVKPQWQQTAPS
FHLNVKQENPIEPYNVKNEQSYAEYMEHFGKKGKLLDQIDDTRSAPSTSRSKVKSPHKER
ENFRSTLVNVIMQQDSSLEPDVTDESGIPKATTSAIEKDILRYYYYIHHGIDTDNVAPME
DSWLEHVLQLVPQHLKVLTNSITVLSDEMREDYLLSVKKSIVDFVLKDPREKEDDTKITE
LPPHRAEMEVLPKPWRRSFLSACSYIRDHLNAMNPTMLAVLDLWHSTFKKLRLVDIEEFH
NRQDALELSGFQNIVIKHMESAKETLLKTWFPEVQNIYYQGNKKKQLPTGDSSAKLESFF
NCAATLMTLQLQDLILVSMQDFTDLIAQPPESIRAFEHPGFIMRLVLDKKAVKFEPEFTD
YIDILVNVYEIMIKAVSFVPRVETKLYSKWESKSKPTTLKPIILDEIIDAHKEKIREVVL
RESVAPTEHLKMYDKYQFLITRQAEQDIEEFLTQSQNYERLIEEIRKYQKLGEEIQYTSR
KTVRLGMFEMHCEELIRSLVKRADIICGKLIAKMFRDHQEVNTMLCEEFEKIAEKALSTP
PNTAELMEMKAHIQKVETTDMLDLGQRLVDSKNCLAFLIECVNFSPADIRLNNSVFQWYG
RMGEIFDEHRKIIKDKTEQYQEGLKLRCERFVEELESYAKQAEEFYTFGDLQDVQRYLKK
AQVLNSKLDAAADKIEQFNAEEEAFGWIPSVYPQRKKIQDGLNPYLRLYETAVEFSTKHR
AWTEGPYHKVNPDQVEADVGNYWRGLYKLEKAFHDSPNALAMTKKVRARVEDFKQYIPLV
QVICNPGLRPRHWEAMSAIVGYPLQPSDDSTVFSFIDMNLEPFLDRFEGISEAASKEYSL
EKSMDKMMTEWEAMEFVIHPYRESGTFILSAVDDIQMLLDDHIIKTQTMRGSPFIKPYEK
QMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMSQMPEEGRRFTAVDKTWRDVM
KMVVQNKHVLAVVTIERMLERMKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLE
ILSETKDPTRVQPHLKKCFEGIARVEFTETLDITHMKSSEGEVVELVDTISTTKARGQVE
KWLVELERIMIKSIHKVIGDAITAYTKNARINWVRDWPGQTVLCVSQTFWTVEVQVAIPM
GHKALEDYLGKCNHQIDDIVTLVRGKLSKQNRVTLGALVVLDVHARDVLANLVKKRISDD
TDFEWLSQLRYYWHENNLETKMINAGLRYGYEYLGNSPRLVITPLTDRCYRTLFGALHLH
LGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDE
FNRIDLEVLSVVAQQILTIQIGINSGTELLVFEGTELKLDPTCAVFITMNPGYAGRSELP
DNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSIKIVATYRLCSEQLSSQHHYDYG
MRAVKSVLTAAGNLKLKYPNENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKL
PKPDYNDLLAAIRENCHSMNLQMTNFFSEKILQIYEMMIVRHGFMIVGEPFGGKTSAYRV
LAGALGDICEKGLMEENKVQITVLNPKSVTMGQLYGQFDLVSHEWSDGILAVSFRAFAAS
STPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASP
ATVSRCGMIYMEPQMLGWRPLMVSWINTLPQSVSIIQKEFIEGLFDRMVPLSVEFIRRHT
KELSPTSDTNLVRSLMNLIDCFMDDFADENKQKERNDRENFSLLEGIFLFSLIWSVGASC
TADDRIKYNKILRELMEGPISDLTRNKFKLLSGTEQTSSKALTVPFPEKGTIYDYQFIPE
GLGRWDQWIKKLADTPPIPKDVQFNEIIVPTLDTVRYSALMSLLTTHQKPSIFVGPTGTG
KSVYIINFLLNQLNKDIYKPLIVNFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKRMIV
FVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSMIKLVDIQIMCAMGPPGGGRNP
ITPRYMRHFNIITINEFSDKSMFTIFSRILTWHLRTCYKFPDDFLDLTTQIVNGTMTLYK
DAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETAENKEAIKRLWVHEVLRVYYDRLL
DNADRSWLVNYIQEILRNYMQEDFHDLFKNLDFDNDGIVEEDDLRSLMFCDFHDPKREDF
GYREIPNVDALRVIVEGHLDEYNNMSKKPMNLVLFRFAIEHISRISRILKQPRSHALLVG
VGGSGRQSVTRLAAHMADYSLFQVEISKGYGSHEWHEDLKVILRKCAEGDMQGVFLFTDT
QIKRESFLEDVNNLLNAGEVPNLFALDEKQEICEKMRQLDRQRDKTKQTDGSPIALFNMF
IDRCRNQLHVVLAMSPIGDAFRIRLRKFPALVNCCTIDWFQSWPEDALEAVASRFLEDIE
MSEEIREGCIDMCKSFHTSTINLSTTFHNELQRYNYVTPTSYLELISTFKLLLEKKRNEV
MKMKRRYEVGLDKLDSASSQVATMQGELEALHPQLKVASRQVDDMMIMIEKESIEVAKTE
KIVKADETVANDQAMAAKAIKDECDADLAEALPILESALAALDTLTAQDITVVKSMKSPP
AGVKLVMEAICILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGDIRFLQSLHEYDKDNIP
PAYMNIIRKSYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAE
GELRIAMEGLRKKQAALREVQDKLAKLQDTLELNKQKKADLENQVDLCSKKLERAEQLIG
GLGGEKTRWSNSALELGHLYVNLTGDILISSGVVAYLGAFTSNYRQHQTKEWSHSCKERD
IPCSDDYSLMGTLGEAVTIRAWNIAGLPSDLFSIDNGIIIMNARRWPLMIDPQGQANKWI
KNMEKTNSLQLIKLSDPDYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGS
TCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVAR
ERPDLEEEKQALILQGAENKRQLKEIEDKILEVLSSSEGNILEDETAIKILSSSKALANE
ISQKQEVAEETEKKIDNTRMGYRPIAVHSSILFFSIADLANIEPMYQYSLTWFINLFILS
IENSEKSDILSQRLHILRDHFTYSLYVNICRSLFEKDKMLFSFCLTVNLLIHENAINKAE
WRFLLTGGIGLDNPYTNPCTWLPQKSWDEICRLDELHAFKTIRREFMRLKEGWKKVYDSM
EPHHEIFPEEWENKANDFQRMLIIRCLRPDKVIPMLQEFIIKKLGRSFIEPPPFDLAKAF
GDSNCCAPLIFVLSPGADPMNALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKD
GTWVVLQNCHLATSWMPTLEKVCEELSPESTHPDFRIWLTSYPSPNFPVSVLQNGVKMTN
EAPKGLRANIIRSYLMDPISDPEFFGSCRKPEEFKKLLYGLCFFHALVQERRKFGPLGWN
IPYEFNETDLRISVQQLHMFLNQYEELPYDALRYMTGECNYGGRVTDDWDRRTLRSILNK
FFCTELVENPQYKFDSSGIYFVPPSGDHKSYIEYTKTLPLIPDPEIFGMNANADITKDQS
ETQLLFDNILLTQSRSSGSGAKSSDEVVNEVAGDILGKLPNNFDIESAMRRYPTTYTQSM
NTVLVQEMGRFNKLLITIRESCINIQKAIKGLVVMSTELEEVVSSILNVKIPGMWMGKSY
PSLKPLGSYVNDFLARLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNYARKFTIPID
LLGFDYEVMDDKEYKNAPEDGVYIHGLFLDGASWNRKTKKLAESHPKVLYDTVPVMWLKP
CKKSDIPKRPSYVAPLYKTSERRGTLSTTGHSTNFVIAMILPSDQPKEHWIGRGVALLCQ
LNS
NT seq 12072 nt   +upstreamnt  +downstreamnt
atgagcagcgagcaggataaactatccactaaagaaaaatctaagacaccagtgagattc
ctaccacagttggctatggacaaaccatccagtaaagaaaaggccaagacgccgacaaga
gctttaccacagttaactttgacaggggtcaagccccagtggcagcagactgctccatca
ttccatttaaatgtcaaacaggaaaacccgatagaaccctataatgttaaaaatgagcag
tcatatgctgaatacatggagcactttggaaaaaaaggcaaattactggaccaaattgat
gatacccgttctgcaccatcaacttccagatcaaaggtcaaatctccacataaggagaga
gagaatttcagaagcaccctcgtcaacgtcattatgcagcaagattcgagtttagagccc
gatgtcactgatgagagcggcattccaaaagcgaccacttctgcaatagagaaagacatc
ttgagatattactattacatccatcatggaatcgatactgataacgtggccccgatggag
gactcctggctggagcacgtgttgcagttggttccacagcatctgaaagtcctgactaac
agcatcacggtcttgtcggatgagatgagagaggattaccttcttagtgtgaagaagtcc
atagttgattttgttttaaaagatcccagagaaaaagaggatgataccaagataactgaa
ctccctccacaccgcgctgaaatggaagtcttgccaaagccgtggaggaggtctttccta
tctgcatgtagttatattagggaccacttgaacgctatgaaccccactatgctggctgtg
ctggatctgtggcacagcacttttaagaaattacgcctagttgacatagaagaatttcac
aaccgtcaggatgcattagagctgtcgggatttcagaacattgtcattaaacacatggaa
tccgccaaggagactctgcttaaaacgtggtttccagaagtgcagaatatttattaccaa
ggcaataaaaaaaagcaattgccaactggcgacagcagcgccaaattggagtcttttttc
aactgtgctgctacactcatgaccttacagctgcaggacctcattctcgtctccatgcaa
gacttcacagacctcatcgcccaacctcccgaatcaattagagcttttgagcatccaggt
ttcatcatgaggctggttcttgataaaaaggccgttaaatttgaacctgaatttactgac
tacatagatatccttgtaaatgtttatgaaatcatgattaaggctgtcagctttgtgcca
agagttgagacgaaattgtattccaagtgggaaagcaaatccaagccaaccaccttgaag
cccataattctggatgaaattatagatgctcataaagaaaagattagggaggtggtttta
cgagagagtgtggcgccaacagagcacctcaaaatgtatgacaaatatcagttcttgatt
actagacaagctgagcaagatattgaagagttcctgactcaaagtcagaactatgagaga
ctaatagaggaaattcgcaaataccaaaagctgggagaagaaatacagtacacatctcga
aagactgttcgtctgggaatgtttgagatgcactgtgaggaactgatcagatccttggtg
aagcgggcagatatcatctgtgggaaactgatagccaagatgttccgagatcaccaggaa
gtaaacacaatgttatgcgaggagtttgagaagatagctgaaaaggctctgagtacgcct
ccaaacacagccgagctcatggagatgaaggctcacattcagaaagtggagacaactgac
atgttggacctgggacagagattagtggattctaaaaactgcctggccttcctcatcgaa
tgtgtcaacttttctcctgcagacatcagactaaataacagtgttttccagtggtatggc
agaatgggagagatttttgacgagcacaggaaaatcattaaggacaaaacagaacagtat
caagaaggtcttaagttgcggtgtgagcggtttgtggaagaattggagagttatgccaag
caagcggaagaattctacacatttggagacctgcaggatgtgcagaggtacctgaaaaag
gcccaggtgctgaacagcaagctggatgcagcagcagacaagattgagcagttcaatgca
gaagaggaagcatttggctggatcccatcagtctatcctcaacgtaaaaagatccaggat
ggtttgaacccgtatcttcgtctctatgaaactgctgtggagttcagtaccaagcacaga
gcgtggactgaaggaccttaccacaaggtgaacccagaccaagtagaagcggatgttggg
aactactggagagggctgtataagctagagaaggccttccatgattctccaaacgcactg
gcaatgaccaagaaagtgcgagcaagggtggaggatttcaagcaatacatccctcttgtc
caagtgatctgtaatcctggtctgcgccccaggcactgggaggccatgtccgccattgtt
ggctacccgttgcagccctcggatgattctacagtcttctctttcatagacatgaatttg
gagccatttttagacagatttgaaggcattagtgaagcagctagcaaagagtattctctt
gaaaagtccatggataagatgatgactgaatgggaagccatggagtttgtcattcatcct
tacagagaaagtgggacattcattttgtccgcagtcgatgacattcagatgttgctggat
gaccacattatcaaaacacaaactatgcgaggatctcctttcatcaaaccttatgagaag
cagatgagggaatgggagggcaagctgttgctgctgcaggagatcctggatgagtggctc
aaggtccaggccacgtggctctatctggagcccattttcagttctcccgacattatgtct
caaatgccagaagaaggcaggcgatttacagcagtggacaaaacctggagggatgtgatg
aaaatggttgtgcaaaataagcatgttctggcagttgtgactatcgagaggatgctggag
aggatgaaaaagtccaacgaactcttggagctcattcttaaagggctgaatgagtacttg
gaaaagaagcgcctcttcttccccaggttcttcttcctgtcgaatgatgagctccttgag
atactgtctgagactaaggaccccacccgagtgcagcctcacctcaagaagtgctttgaa
ggaattgcaagggttgaatttacagaaactttggatattacacatatgaagagtagtgaa
ggagaagtcgtggagctcgtagataccatttcaacaaccaaagccaggggccaggtggag
aagtggttggttgagttagagaggattatgattaagtccattcacaaggtgattggagat
gcaattactgcttatacaaaaaatgcacgaattaattgggtaagagattggcctggacag
actgttctctgtgtatctcaaaccttttggacagtagaagtccaagttgctatacctatg
gggcataaggcccttgaagactacttgggaaaatgtaaccatcaaattgatgatattgtc
acgttggtccgtggcaaattgtccaagcagaaccgtgttacactgggagcccttgtggta
ctggatgttcacgctagagatgtccttgccaaccttgtaaagaaaagaatcagcgatgac
actgactttgagtggttaagtcagcttagatactactggcacgaaaataatttagagaca
aagatgatcaatgctggtttgcgatacggctatgaatatctgggaaattcccccagatta
gttataacccctctcacagaccgctgctacaggaccttatttggagcccttcacctgcac
cttggaggagcacctgagggtccagctggcactggaaagacagaaacaaccaaggattta
gcaaaagctgttgccaaacagtgtgttgttttcaactgctccgatgggctggattatttg
gctttaggaaaattctttaagggactgttatcttgtggagcctgggcttgctttgatgag
tttaacagaattgatttggaagtactttctgtggttgctcagcaaatccttactatccag
ataggcattaactcaggtaccgagctcctagtgtttgaaggaacagaactaaaacttgac
cccacgtgcgctgtctttattacaatgaaccctgggtatgctgggcggtcagagttgcca
gacaacctgaaggctctcttccggacagttgccatgatggtgcctgactatgccatgatt
gctgagatcgtgctttattcctgtggctttgtcactgcacggccactgtccataaaaatc
gtggctacataccgcttgtgctcagagcaactgtcctcccagcaccattatgactacggg
atgcgagccgtgaagtctgtgctcacagctgctggcaatttgaagctgaaatatccaaat
gaaaatgaagaaattttgctgcttagatctattattgatgtaaacctgccgaagttttta
tcccatgatttgccactctttgagggaattacctcagatttgtttcctggggtgaaatta
ccaaagccagattacaatgatctgctggccgccatcagagagaactgccactccatgaat
ttgcagatgaccaacttcttctctgagaagatccttcagatctatgagatgatgattgta
cgccatggtttcatgattgttggagagccgtttggaggcaagaccagtgcatatcgtgtt
ctagctggagcattaggtgacatttgtgaaaaggggctaatggaagaaaacaaggttcaa
ataaccgttttaaatcccaagtctgtcaccatgggccagctttatgggcagtttgactta
gtgtcccacgagtggtctgatgggatcctggctgtcagctttagagctttcgcagcttcc
tcgactccagacaggaagtggttaatctttgatgggccagttgatgcggtgtggattgag
aacatgaatactgtgctggatgacaacaagaagctgtgtctgatgagcggggagattatt
caaatgtcaccacaaatgaatctgatctttgaaccaatggacctagaagtcgcctctcct
gccactgtttctcggtgtggcatgatctatatggagcctcagatgctgggctggagacca
ctgatggtgtcctggataaacactttaccacagtcagtcagtatcattcagaaggagttt
atagaaggcttgtttgatagaatggtgcctctttctgttgagttcattagaaggcataca
aaggagctctctcctacttcagatacaaacttggtccgatccttaatgaatctcatagac
tgctttatggatgactttgccgatgaaaacaaacaaaaagaaagaaatgaccgggaaaat
ttctctttgttagagggcatttttctgttttcattgatctggtctgtcggtgcatcttgt
acagctgatgatcgtataaaatacaataagatcctccgagagttgatggaaggtccaatt
tcagacctaactcgaaataagtttaaattactgagtggtactgagcaaacgtcctcaaag
gcattaacagtgccctttcctgaaaagggaacaatatatgattatcagtttatcccagag
ggcttaggaagatgggatcaatggataaagaaattggcagatactcccccaattcccaaa
gatgtacagtttaatgagatcattgtgccaactctagacacggtccgttactctgctcta
atgagtttactgaccactcatcaaaagccttcgatatttgtaggaccaacaggcactggg
aagagtgtttatatcattaattttcttttaaatcaactcaataaggacatctacaaacct
cttatagttaacttctcagcccaaactacagcagcccaaactcagaatatcatcatgtca
aaactggacaaaagaagaaaaggagtttttggccctcctttaggcaagagaatgattgtc
tttgtagacgacgtgaatatgcctgctcgagaggtctatggggctcagccacccattgag
ttacttagacagtggttagatcattggaattggtacgacctcaaagattgctctatgatt
aaactggtggacatccagatcatgtgtgctatgggccctccaggtggtggccgaaatcca
ataactcctcgatacatgagacatttcaatattataaccatcaatgagtttagtgacaag
tccatgttcacaatcttctccagaatcctgacctggcatttaaggacctgttataagttt
ccagatgattttctagatttgacaacacaaattgtaaatggcacaatgaccctgtacaaa
gatgccatgaagaacctcttacctactccagctaagtctcactatctgttcaaccttcgt
gatttctcccgagtcatacaaggtgtttgtttgtcaagaccagaaactgcagaaaacaaa
gaggccattaaacgcctgtgggttcatgaggtcctccgagtatattatgatcgccttctg
gataatgctgatagaagctggcttgttaactacatacaagaaattctgagaaattacatg
caggaagattttcatgacctatttaaaaacttggattttgataatgatggcattgtagaa
gaagatgatttaagaagtttaatgttctgtgatttccatgatcctaaaagggaagatttt
ggctacagagaaattccaaatgtggatgctctcagggtgattgtagaaggccatttagat
gaatataacaacatgagcaagaaacccatgaacctcgtcttattccgttttgccatagaa
cacataagtagaatttctcgaatcctgaagcagccgcgaagccacgccctcctggtgggg
gttggcgggagcggaaggcagtcagtcacccgactggctgcacacatggcggattattca
ctcttccaggtggagatctccaagggctatggtagccacgagtggcatgaagatctaaaa
gtgatcttaagaaaatgtgcagaaggtgacatgcagggggtcttcctgttcacagacacg
cagatcaagagagagtcgtttctagaagatgtcaacaatctcctaaatgctggggaggtt
ccaaacctctttgctttagatgagaagcaagaaatatgtgaaaagatgcgtcagttagat
cgtcaacgggataaaaccaaacagacagacgggagtcccatagctcttttcaacatgttt
attgaccgctgccgcaaccagcttcacgtggtcctagccatgagtcccatcggagatgca
tttcggattcgtcttcggaaattccctgctcttgttaactgctgtaccattgattggttt
cagtcatggccagaagacgcactggaagcagttgcttcacggttcctggaagacattgag
atgtcagaggaaatccgggaaggctgtattgacatgtgtaaaagcttccacacttctact
atcaacttatcaacgaccttccataatgaacttcaaagatataattatgtgactcccacc
tcttacctggaattgatctctaccttcaaactgttgttagaaaagaaaagaaacgaagtg
atgaaaatgaaaaggagatacgaggtgggtttggataaactggactcggcttcgtctcag
gtggccaccatgcagggcgagctggaggcactccatcctcagttaaaagttgccagcaga
caggttgatgacatgatgataatgattgagaaggagtccattgaggttgccaaaactgag
aagatcgtgaaagctgacgagacagtagcaaacgaccaagccatggccgccaaagccatt
aaagacgaatgcgatgccgacttggccgaagccctacccatcctggagtctgcgctggct
gcccttgataccctgaccgcgcaggatatcaccgttgtgaagtccatgaagagtccccct
gctggcgtcaagcttgtcatggaagctatctgcatattgaaagggatcaaagctgacaaa
atccctgacccaacaggttccgggaagaaaattgaggatttctggggccctgctaagaga
cttcttggtgacataagatttcttcagtcacttcatgagtacgacaaggacaatattcct
cctgcttatatgaatatcataaggaagagctatatccccaacccagacttcgttccagaa
aagattcggaatgcttcaacagctgctgaaggtctctgcaagtgggtcatcgccatggac
tcctatgacaaagtggcaaaaattgtagctcccaaaaagataaagctggctgcagctgaa
ggggagctgaggattgctatggaaggccttagaaagaagcaggctgccctgcgtgaggtt
caggacaagctggccaagctccaagacacacttgagttgaataagcagaagaaagcagac
ttggaaaaccaggttgatttgtgcagcaaaaagctagaacgagcggagcagctgattgga
ggcctgggaggtgagaaaacccgatggagcaactccgccctggagctcgggcacctgtac
gtcaacctgacaggtgacatcctcatctcctcaggggtcgtggcctacctgggggccttt
acatctaactacagacagcaccaaaccaaggaatggtcacactcgtgtaaagaaagagac
atcccctgctcagatgactactctcttatgggtacgctgggagaagctgtgacgattcga
gcttggaatatagctggattaccctccgacttgttctccattgataatgggatcattata
atgaatgcaagaaggtggcctctgatgatagaccctcaaggtcaggctaacaaatggatc
aagaacatggagaaaaccaatagtcttcagcttattaaactaagtgaccctgactacgtg
aggactctggaaaactgtatccaatttggaactcctgtgttactagaaaatgtgggagaa
gaactggacccgattctagagcctcttctgttgaagcagaccttcaaacagggtgggagc
acatgtatccggcttggagactccactattgaatatgctcctgacttccgcttctacatc
acaaccaagctgagaaacccacactatctcccagagacgtcagtgaaggtcacattatta
aacttcatgataactcccgagggaatgcaggatcagcttttgggaattgtagtggctcgg
gaaaggccagaccttgaagaagaaaagcaagccttgatactgcaaggagctgagaacaaa
aggcagttaaaggaaatagaagacaagattttagaagttctctcatcttcagaaggcaat
atattagaagatgagactgcgattaagatattatcttcctccaaggctttggctaatgag
atttctcagaagcaggaagtggctgaggagacggagaaaaagatcgacaacacccgcatg
ggctatcggcccatcgccgtccattcttccatcctgttcttctccatcgctgatctagcc
aacatcgagcccatgtaccagtattcactgacctggtttattaacctgttcatcctgtcc
attgaaaattcggagaaatcagacatcttatcacaaaggcttcatattctcagggatcac
ttcacctactcactctacgtcaacatctgccgttcgctctttgaaaaggacaagatgctg
ttttccttttgtctcactgtgaatctgctgatacatgaaaatgcgattaacaaagcagag
tggagatttctgctcactggtggcattgggctggataatccttataccaacccttgcaca
tggcttcctcaaaagtcctgggatgagatttgccgactagatgaattacatgccttcaag
accattcgcagggagtttatgcgcttaaaggagggatggaaaaaagtatatgatagtatg
gagccacaccatgagatatttcctgaagagtgggagaataaagcaaatgattttcaaagg
atgcttattatccgttgcttgaggccagacaaggttattccaatgctgcaggaattcata
atcaagaagttggggcgctctttcattgagccgcccccctttgacctggccaaggcattt
ggggacagtaactgttgtgcacctttgatctttgtgctctcccctggagcggatcccatg
aatgctcttctgaaattcgctgatgaccagggatacgggggctcaaaacttagctctcta
tctctgggccaaggccaagggccaatcgctatgaagatgttagagaaagctgtcaaggat
ggaacatgggttgttcttcaaaactgccaccttgccacctcttggatgccaactcttgag
aaagtttgtgaggagttaagcccagaatcaacacaccctgatttccgaatctggctgacg
agttacccatctccaaatttccctgtgtcggtcctgcagaatggagtaaaaatgaccaac
gaagcaccgaaaggactgcgggctaatatcatccgatcatacctcatggacccgatctct
gaccctgaattctttggcagctgcaggaagcctgaggaattcaagaaattgctttatggc
ctctgtttctttcatgctttggtacaagagagacgaaaattcggacccctggggtggaat
attccttatgaattcaatgagacagatctaagaatcagtgtgcagcaactccacatgttt
ctgaaccagtatgaggaacttccgtatgatgctctccgctacatgactggggaatgtaat
tacggaggccgggtgacggacgactgggaccggcgtacactgcgcagcattctcaacaaa
ttcttctgcacagaattagtcgaaaacccacaatacaaatttgactcaagtggcatctat
tttgtccctccttctggtgatcacaaaagctacattgaatacacaaagactcttccactg
atcccagacccagaaatctttgggatgaacgccaatgccgacatcactaaggaccagtcc
gagacgcagctgctgtttgataacattctcctcacccagtctcgctcatcaggttctgga
gcgaagtcatcggatgaggtagtcaatgaggttgctggagacatcctgggtaaacttcca
aacaacttcgatattgaatctgccatgaggagatacccaacaacctacactcagagcatg
aacaccgtccttgtccaagagatgggccgtttcaataagctgctgataaccataagggaa
tcatgcattaatattcaaaaagcgatcaagggactcgttgtgatgtctacagagctggag
gaagtggtcagcagcatcctgaatgtcaaaattccagggatgtggatgggtaaatcctac
cccagcttgaagccacttggcagctatgtgaatgacttcctcgcaagactaaaattcctg
cagcaatggtatgaggttggtcctcctccagtcttctggctttctggcttcttcttcaca
caagccttcctgactggtgcacagcagaactatgcaagaaaattcacgattccaattgat
cttcttgggtttgactatgaagtgatggatgacaaggaatataaaaatgctcctgaggat
ggtgtttacattcatggattgtttttggatggagcttcctggaacaggaagaccaagaaa
cttgcagaatcacatcctaaagttctctatgacacagtccctgtgatgtggctaaagccc
tgtaagaagtcagacatacccaaacgaccaagctacgttgctccactgtataagacaagt
gagaggaggggcacgctctccaccactggccactccacaaatttcgtgattgccatgatt
cttccctctgaccaacccaaggaacactggattggacggggtgtggcactgctatgtcaa
ctgaactcataa

KEGG   Rattus norvegicus (rat): 252959
Entry
252959            CDS       T01003                                 

Gene name
Dnah12
Definition
(RefSeq) dynein heavy chain 12, axonemal isoform X1
  KO
K10408  dynein heavy chain, axonemal
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    252959 (Dnah12)
   05016 Huntington disease
    252959 (Dnah12)
   05022 Pathways of neurodegeneration - multiple diseases
    252959 (Dnah12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    252959 (Dnah12)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     252959 (Dnah12)
SSDB
Motif
Pfam: AAA_6 DHC_N2 Dynein_C AAA_8 AAA_9 AAA_7 AAA_lid_11 MT Dynein_heavy Dynein_AAA_lid AAA_5 AAA_lid_1 AAA BCDHK_Adom3 AAA_18
Other DBs
NCBI-GeneID: 252959
NCBI-ProteinID: XP_006252733
RGD: 619990
Ensembl: ENSRNOG00000059865
UniProt: A0A0G2K7D4
Position
16
AA seq 3960 aa
MSDPNKTAITAEKEALNLKLPPIVHPPKNIGVDTPKQSELLNYRRSKEQQKKINQLVISA
AKKSLDKTLDKRIPPLPEPDFPPTMTSEIKKKGLNYIFMKQCVESSPIVPIQPQWLDHML
MLIPEHLKEGKKREELLGSLINEVSMDFEKSMKRYLVQSVLVKPPVKWLEDEWGPLPESP
EGLDYSNPWHSNFVQARSQILANLHIVHPTMKLLLELGYTTFSDIILLDLTGIRDRGPID
CEALRNDLSIQARKAEERIMNTWYPKVINLFTKKEALEGIKPEKVDSFYNCVSILMSNQL
KDLLWRTVEEFVRLFDSRYILRLPIFKMELTFDDDKMEFYPTFQDLEDVVLGLIERISET
LQTVQTVPSWLSGTTAPVNLDTELPEHVMYWALSTLRIAVHQNLEGVRAHYKTYVTNYNW
LLDGTATKMIERFQSENHTFDEYTEFIERFFSLASEIMLLPQWAHYPMVRLDCEDLKTGL
TNKAKAFANILLNDIASKHRKENESICSEFETIKEHALRVPETTEEMMELIAFIEKARTT
GIQNLAQRIQESKRQMGYFLDTFLLSQEDLNLNASVLLWPSKINPVFDENDELIENSKRT
KENELIAKREKLILEIEKESRRMEEFTEFAELDRMQQYVADVRHLQKRIQDSEEAVQFIN
KEEELFKWELTKYPELEKLKVTIEPYQKFFNFVLKWQRTEKRWMDGGFLDLNGESMEADI
DEFSREVFKTLKFFQTKQKKELQEKRKAARKRSLMEEKPEEEPKESPTITMCATVMEQIK
VFKEYIPTVSILCNPGMRARHWKQMSEIVGYDLTPDSGTTLRKVLKLNLTPYLESFEVIS
AGASKEFSLERAMNAMIATWDDISFHISLYRDTGVYILSSVDEIQAILDDQIIKTQTMRG
SPFIKPFENEIKAWEDRLIRIQETIDEWLKVQAQWLYLEPIFCSEDIMQQMPEEGRQFQT
VDRHWKDIMKFCAKDPKVLAATSLTGLLEKLQNCNDLLDKIMKGLNAYLEKKRLFFPRFF
FLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFLTNLDIKAMYSSEGERVELISVIS
TSAARGAVEKWLIQVEDLMLRSIHDVIAASRLAYPESARKDWVREWPGQVVLCVSQMFWT
SETQEVISGGNEGLKKYYKELQYQLNDIVELVRGKLSKQTRITLGALVTIDVHARDVVMD
MIDMGVSHDTDFQWLAQLRYYWEYENARVRIVNCNVKYAYEYLGNSPRLVITPLTDRCYR
TLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLAS
SGAWACFDEFNRIELEVLSVVAQQILCIQRAIQQKLEVFVFEGTELRLNPNCFVAITMNP
GYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQL
SSQFHYDYGMRAVKAVLVAAGNLKLKYPNENEDILLLRSIKDVNEPKFLSHDIPLFNGIT
SDLFPGIKLPEADYQEFLECAYEACETQNLQPVKFFLEKIIQTYEMMIVRHGFMLVGEPF
AAKTEVLHILADTLTLMNERNYGDEEKVMYRTVNPKSITMGQLFGQFDPVSHEWTDGIVA
NTFREFALAESPDRKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSPQMSLIFE
TMDLSQASPATVSRCGMIYLEPSQLGWEPIVASWLNSLKEPLNELEHQNLLKELFNWLVQ
PSLEFRRKKCKELIPTGNINAVVALTRLIEILLCTVVENDPSSKHIRVWIMATFVFSLIW
SVGASCDTDGRLAFDNFLRSLVTGKNDKAPMPVFINKWECPFDEKGLVYDYMYELRNRGR
WIHWNDLIKSSDIEDRRTKIQDIIVPTMDTIRYTFLMDLCISHAKPLLFVGPTGTGKSVY
VKDKLMNHLEKGKYFPFYVNFSARTSANQVQNIIMARLDKRRKGVFGPPMGKKCVVFIDD
MNMPSLEKYGAQPPIELLRQFFDCGHWYDLKDTTKITLVDIELIAAMGPPGGGRNAVTPR
FIRHFNICTINSFSDETMVRIFSSIMMFYLRTHDFSPEYFVLGHQIVSATMEIYKQSMGN
LLPTPAKSHYTFNLRDFSRVIRGCLLIDKEAIESKHTMIRLFVHEVLRVFYDRLINDEDR
NWLFLLIKNVIKDHFKESLENVFSHLRRGNSSINEEDLRNLMFGDYMNPDLEGDDRVYIE
ILNIHQFNEVVDQCLDEYNQTHKRRMNLVVFRYVLEHLSRICRILKQSGGNALLIGLGGS
GRQSLTSLATSMAKMQIFQPEISKSYGMNEWREDIKSLLRNVGVKGQKTVFLITDTQIKE
EAFLEDIDSVLNTGEVPNIFAADEKQEVMEGVRPVAQVGNKHGELSPLALFAFFVNRCKD
NLHVVVAFSPIGDAFRNRLRQFPSLINCCTIDWFQPWPEDALERVAVSFLETVELTEVER
HEIVPICKHFHTSIMNLSERFLEELGRHNYVTATSYLELIGSFRQLLTKKRQSVMEAKQR
YVNGLDQLAFAESQVGEMKLELVELQPKLEAAKVENARMMQIIEIESAQVEAKRKIVKLD
EEIASGKAEEAQALKNECESDLAEAIPALEAALSALDTLKPADITIVKSMKNPPAGVKLV
MAAVCVMKDIKPEKISDPSGTGGKIFDYWGPSKKLLGDMNFLRDLREYDKENIPVAVMQK
IRSEYLTNPEFDPPKVAKASSAAEGLCKWIMAMEVYDRVAKVVAPKKARLAEAQKSLAET
MELLNQKRGELAQVEHHLENLQKTFQEKTEEKAALEDQVELCAKKLERATKLIGGLGGEK
SRWSQAANDLQATYENLTGDVLVSAGVIAYLGAFTSGFRQECTEDWSKLCKEKKFPCSEE
FSLSKTLGDPVKIRAWNIAGLPTDTFSIDNGVIVNNSRRWPLMIDPQGQANKWIKNSEKD
NQLSVIKLSDSDYMRTLENCIQLGTPVLLENVGEDLDPSLEPLLLRQTFKQGGIDCIRLG
EVIIEYSFDFKFYITTKLRNPHYMPELATKVSLLNFMITPEGLEDQLLGIVVAKERPELE
EERNALILQSAANKKQLKDIETRILETLSCSEGNILEDESAIKVLDSAKMMSNEITKKQQ
VAEKTELKIAESREGYRPIAKHSSVLFFSIADLANIDPMYQYSLTWFVNLYINSIHDSNR
SKILEKRLRYLNDHFTYNLYCNICRSLFEKDKLLFSFLLCANLLLAKKEIEYQELMFLLT
GGVSLKSAEKNPDPNWLQDKSWEEICRASELPVFHGLREHFCNHIREWEDIYNSKEPHNM
KLPESMDKTLNELQKIIILRCLRPDKITPAITNYVTDKLGKKFVEPPPFDLTKSYLDSNC
TIPLIFVLSPGADPMASLLKFANDKSMSGNKFQAISLGQGQGPVATKMITAAIEEGTWVC
LQNCHLAVSWMPTLEKICEDFSPEICNPTFRLWLTSYPSPKFPVTILQNGVKMTNEPPTG
LRLNLLQSYLSDPISDPEFFNGCPGKELAWEKLLFGVCFFHALVQERKKFGPLGWNIPYG
FNESDLRISIRQLQLFINEYDTIPFEAISYLTGECNYGGRVTDDWDRRLLLTMLADFYNS
LIIENPHYKFSPSGNYFAPPKGTYDEYIEFIKKLPFTQEPEIFGLHENVDISKDLQQTKL
LFESLLLTQGGVKQTGSSGSTDQILLEITEDILTQLPNDFDIEAALRSYPVRYEESMNTV
LVQEMERFNNLIITIRNTLRDLKKAIKGVVVMDSALEALSGSLLIGKVPEMWAQRSYPSL
KPLGSYITDFLTRLKFLEDWFTMGKPNVFWISGFFFTQAFLTGAMQNYARKYTIPIDLLG
YEFEVIPSDNATNPPEDGVYIHGLYLDGARWNRTSGLLAEQHPKLLFDLMPIIWIKPNVK
TEIVKTDAYVCPLYKTSERKGTLSTTGHSTNFVIAMLLRTELPAQHWIKRGVALLCQLDN
NT seq 11883 nt   +upstreamnt  +downstreamnt
atgtcagatcctaacaaaactgccattacagcagaaaaggaagctttgaacttgaagttg
ccccctattgttcatccccccaaaaacataggtgttgacacaccaaaacaaagtgagttg
ctaaattaccgaagatctaaggaacagcagaagaaaatcaatcaattagtaatttctgca
gctaaaaaaagtctagataaaaccctggataaaagaatccccccgttaccggagccagac
ttccctccaacgatgaccagtgaaattaaaaaaaaaggattaaactacatattcatgaag
cagtgtgtagagagtagccctatagtaccgattcagccacagtggctggaccacatgtta
atgctgatacctgagcacctaaaggaagggaaaaaaagagaagaactgctcggaagtctc
ataaatgaggtgtcaatggactttgaaaaaagcatgaagagatatttggtacagagtgtt
cttgtgaaacctccagttaaatggcttgaagatgaatggggccctttgcctgaatctcct
gaaggactagattattccaatccttggcattctaactttgtgcaggcaagaagtcaaata
ttagctaatttgcacattgttcatccaactatgaaactattactggagcttggttataca
acattttctgacataattctgctggacttaacaggaattcgagatagaggcccaattgac
tgcgaagcactgagaaatgatctgtcaattcaagcgagaaaggcagaagagaggataatg
aacacgtggtatccaaaggtcataaatctctttactaagaaggaggcgctagaaggcatc
aagcctgaaaaagtggactccttttataactgtgtttcaatacttatgtcaaatcagcta
aaagatctcttatggagaactgtagaagaatttgtaagactctttgattcaagatatata
ctcaggcttccaatattcaagatggaattgacatttgatgacgataaaatggaattttat
cccacctttcaagatttggaagacgttgtcttgggtttgatagaacggatatctgaaact
ttgcagactgtccaaacagtgccttcttggctgtcaggaactacagcgcctgtcaatctt
gatacagaacttccagaacatgtgatgtactgggctctcagtacactgaggatagcagta
catcagaacttagaaggtgtaagagcacattataaaacatacgttacaaactacaactgg
ctccttgatgggacagcaacaaagatgatagagagatttcagtcagaaaaccatactttt
gatgaatacacagaatttatagaaagatttttcagtcttgcttcagaaataatgcttttg
cctcagtgggctcattatcctatggttcgtttggactgtgaagacttgaagacaggcttg
acaaataaagcaaaagcctttgcaaacattttattaaatgacatcgcttcaaaacataga
aaagaaaatgaatctatttgcagtgaatttgaaacaattaaagagcatgctctacgagtt
cctgagacaacagaagaaatgatggaactaattgctttcatagaaaaagctcgaaccaca
ggaattcagaacttggctcaaaggatccaggaatctaaacgccaaatgggttacttttta
gatacttttctattgtctcaagaagatttaaatttaaatgcaagtgtcctcttgtggcct
agtaaaattaaccccgtctttgatgagaatgatgaactcattgagaattctaaacgtacg
aaagaaaatgaactaatagccaagagagagaaactgattttggaaatagaaaaagagtcg
cgccgcatggaggagttcacagagtttgcagaactggaccgcatgcaacagtatgtggca
gatgtaagacatctacagaaacgtattcaggattcggaagaagctgtccagtttattaat
aaagaagaggaacttttcaaatgggaattgacaaagtatcctgaactggaaaaattaaaa
gtcaccattgaaccctaccagaagtttttcaattttgttctgaagtggcagcgaacagaa
aaacggtggatggatggagggtttctggaccttaacggagaaagcatggaagctgatata
gatgagttttcccgagaagtttttaagacactgaagttcttccaaactaagcaaaagaaa
gaattacaagaaaaaagaaaggcagcaagaaagcgatctttgatggaagagaaacccgaa
gaagaaccaaaggagagtcctacaattacaatgtgtgctacagtaatggagcagataaag
gtctttaaggaatatatccctacagtctccatcctgtgcaacccaggaatgagagctcgt
cactggaaacagatgtcagaaattgtgggctatgacttgactccagattctggaactaca
ctgagaaaagttttgaaattaaaccttacaccatatttagaaagttttgaagttataagt
gctggtgcgagtaaggaattttccttagagagggccatgaatgctatgatagcaacttgg
gatgatatttcttttcatataagtctatatcgtgatactggagtctatatcctttcttca
gtggacgagattcaggcaattcttgatgatcagattataaaaacacagacaatgagaggt
tcaccttttatcaaaccatttgaaaatgaaatcaaggcctgggaagaccgtctgattcga
atccaggagaccattgatgagtggttgaaagtgcaagctcagtggctgtacttagagccc
atcttctgttctgaggacatcatgcagcagatgccagaggaagggcggcagtttcagaca
gtagacagacactggaaggatatcatgaagttctgtgctaaagatccaaaggttcttgct
gctacttctttaacaggcttgttggaaaaactacagaattgcaatgaccttctggataaa
atcatgaaaggactgaatgcataccttgagaagaagcgacttttcttccctcgctttttc
tttttatctaatgatgaaatgctagagattttgtcagagaccaaagatccactcagagtt
cagccacacttaaaaaaatgctttgagggcatcgctaagttggagttcctgactaatctg
gatattaaagccatgtacagctctgagggtgaacgagtggagctgatttcagtgatttcc
acgtctgcagcgaggggtgccgtagagaaatggctcattcaagtagaagacctaatgctc
agaagtatccatgatgtgattgctgcatctagactggcttacccagaatctgcaaggaaa
gactgggtcagagagtggcctggccaggttgttctttgtgtgtctcagatgttctggact
tctgagacacaggaagtcataagtggtggaaacgaggggttaaagaagtactacaaggaa
ctccagtatcaactaaatgacattgtggagctggtgagagggaagttatctaagcagacc
aggatcactctgggggctttggttacgattgatgtccacgctagagatgttgtcatggac
atgattgatatgggtgtctcacatgatacagatttccagtggctcgctcaacttcgttat
tactgggaatatgagaacgctcgagttcgtattgtcaactgcaatgtcaaatacgcttat
gagtatcttggtaactcaccacgacttgtcataactcctttaactgacagatgttacaga
acattgataggtgccttctatttaaaccttggaggtgctccagaagggccagcgggcaca
ggaaaaacggagaccaccaaggacctggcgaaagcccttgctgtgcagtgtgtcgtgttc
aactgctccgacgggctggactatctagcgatgggaaagttttttaaaggcctggcttct
tcaggcgcctgggcttgctttgatgaatttaaccgcattgaactggaagtgctgtccgtg
gtggcacagcagatcctttgcatccagagagctattcagcagaaactggaagtgtttgtc
tttgaagggacagaacttaggctcaatccaaactgttttgtggccatcaccatgaatcct
ggctatgcaggacgttctgaattgccagacaacctcaaggttcttttcagaacagtagct
atgatggttccaaactacgccctcatcgcagaaatctccctttactcctatgggtttcta
aacgcaaagcctctgtctgtgaagatagtgatgacctaccggctgtgctccgagcagctg
tcctcgcagttccattacgactatgggatgcgagcagtgaaagccgtgttagtggcagct
gggaacctaaaattgaaataccccaatgaaaacgaggacatactgcttcttcgatcaatt
aaagatgtaaatgaaccaaagtttctctcacacgacatacctttatttaatggaataact
agtgatttatttcctggtattaagcttcctgaagctgactaccaagaatttttggaatgt
gcatatgaagcctgcgaaacacaaaatcttcagcctgttaaattttttcttgaaaaaatt
attcagacatatgaaatgatgattgttcgacatggtttcatgttggtaggagagcctttt
gctgctaagacagaagtgctgcatattctggctgacactttaactcttatgaatgaacgc
aactatggagacgaagaaaaggtcatgtataggactgtaaaccccaaatcaattactatg
ggccaactttttgggcagtttgacccagtgtctcatgagtggacggatggtatcgtggca
aacacgtttagagaatttgccttagcggaatcacctgaccggaaatgggttgtgttcgat
ggccccattgatactctgtggatagagagcatgaatacagtactggatgataacaaaaag
ctttgccttatgagcggagaaatcattcaaatgtcccctcaaatgagcctcatctttgaa
acaatggacctttcacaggcttcgccagccaccgtgagtcgctgcggcatgatttatttg
gagccttcacagttaggatgggaaccaattgtggcttcatggttgaactcactgaaagag
cctctaaatgaactagaacatcagaatctgctgaaagaactttttaactggctagtgcag
ccttctctagagtttcgcaggaagaaatgcaaggaattgatccctacaggtaacatcaat
gcggttgtggcactcacgcgcctcattgaaatcctgctctgtactgtggtggaaaatgat
cccagtagcaagcacatccgtgtctggattatggccacctttgtattctctttgatttgg
tcagttggagcaagttgtgatacagatggtcgtcttgcttttgataatttcctacggtca
cttgtaacaggaaaaaatgacaaagccccaatgccagtcttcatcaataaatgggaatgc
ccatttgatgaaaagggcctggtctacgactacatgtatgagttaagaaaccgaggtcgc
tggatccattggaatgacttaattaaaagttctgatatagaagacagacgtaccaagatt
caagatattatagtccctacaatggacacgattagatatactttcctaatggatttgtgc
atttcccatgcaaagccgctgctctttgtgggtcccactggcacaggaaagtcagtgtac
gtgaaggataagctaatgaatcacttggaaaagggaaagtactttcctttctatgttaat
ttctccgcacggaccagtgccaatcaggttcagaacattattatggctagattggacaaa
aggcgcaagggagtatttggaccacctatgggaaagaagtgtgtagtgttcatagatgat
atgaatatgccttcactggagaaatatggagcccaacctcctattgagttattacgccag
ttttttgactgtggacattggtatgaccttaaggacaccaccaaaatcacactggttgat
atagagctcatagctgccatggggcctccaggcggcggaaggaatgccgtcaccccgcgt
ttcatccgacatttcaacatctgcaccatcaattccttcagcgacgaaactatggtccga
attttctcatcaatcatgatgttctaccttaggactcatgatttttctccagagtacttt
gtactcggacaccaaatagttagtgcgactatggagatatataaacaatctatgggaaat
cttttgcccactcctgcaaaatctcactatacttttaacctgcgtgacttctcacgtgtc
atccggggctgcttactcattgataaagaggccatagagagcaaacacactatgatccgc
ctgtttgtgcatgaggttctccgcgtgttttatgatcgtcttattaatgatgaagatcgg
aattggctcttcctattaattaagaatgttataaaagaccactttaaggagtcacttgaa
aatgtctttagtcatctgaggagagggaactcctccataaatgaagaagacttacgaaac
ctcatgtttggggattatatgaaccctgatctagaaggagatgatcgggtttatattgaa
attctgaatattcaccagtttaatgaagttgttgaccagtgtttagatgagtataatcaa
actcacaaaagaagaatgaatcttgttgtgtttaggtatgttctggaacatttgtcaaga
atatgccgcatcctaaagcagtctggtggcaacgctttgctcattgggcttggaggaagc
ggccggcagtctctgactagtctggctacatctatggcaaaaatgcagattttccaacca
gaaatttctaagagttacggcatgaatgagtggagagaggatattaagtccttgttgaga
aatgttggtgtgaaaggccagaagaccgtcttcctgatcacagacactcagattaaggag
gaagctttcctagaggacatcgacagtgtgctcaacactggtgaagttcctaacattttt
gcagcagacgagaagcaagaagtgatggagggtgtccgtccagtagctcaggtgggcaat
aaacatggtgaactcagtcccttagccctgtttgccttctttgtgaaccgttgcaaagat
aatcttcacgtcgtggtggccttcagccctataggagatgccttccgaaatcgtctgaga
caattcccatccctcatcaattgttgtactattgattggtttcagccgtggcctgaagat
gccctggaacgtgtagctgtgagtttcctagaaaccgtggagctcactgaggtggagcgg
cacgagatagtcccgatctgtaaacactttcacacttccattatgaatctttcagaaagg
ttcttagaagagctgggacgacataactatgttactgctacttcttaccttgaactgatt
ggctcatttcggcagcttttaaccaagaagcggcagtctgtcatggaagcaaaacagcgc
tatgtgaacggacttgaccagttagctttcgccgagtctcaggttggcgaaatgaaactg
gagctggttgagttacagcccaaactggaggcagcgaaagttgaaaatgcacgtatgatg
cagataattgagatagaatctgcacaagtagaagcaaaaagaaagattgtgaagttggat
gaagaaatagccagcgggaaggctgaggaagcccaggctctgaaaaacgagtgtgagagt
gacctggcggaggccattccagccttggaagcagcgctgtctgcactagacacccttaag
ccagccgatattacaattgtaaaatcaatgaagaatcctccagctggggttaaactagtc
atggctgctgtctgcgtcatgaaagatataaagccagaaaagatttcagatccttcagga
actggaggcaagatatttgattactggggacctagcaaaaaactcctgggagatatgaat
tttctccgagatttgagggagtatgacaaggagaacattccagtggctgttatgcagaag
attcgtagcgaatatttgacgaaccctgaatttgatccccctaaggtcgctaaagcctct
tctgctgctgagggtctgtgcaagtggatcatggctatggaagtgtatgacagagttgca
aaggtggttgctccaaagaaagctcgcttagcggaggcccagaagtccttggcagagaca
atggaacttttgaatcagaagaggggtgaactggcccaagtagagcatcatttggaaaac
ttacagaagacttttcaagagaagacggaggaaaaggcagctctggaggatcaggtggag
ctgtgcgctaagaagctagaacgagccaccaagctaattggagggctaggcggagaaaag
tcaagatggtctcaagctgcaaatgaccttcaagcaacatatgaaaacctaactggtgac
gtcttggtgtcagcaggagtcatagcttaccttggtgctttcacttctggatttcgacaa
gaatgtacggaagattggagcaagctgtgcaaggagaaaaaattcccgtgttcagaggag
ttctcattgagtaaaaccttgggggatccagtcaaaattagagcttggaatattgctggg
ctaccaacagacacgttctccatagacaatggtgtgatcgttaacaattctaggcggtgg
cctttaatgatcgacccccagggtcaagcaaataagtggatcaaaaactctgagaaagat
aatcagctcagtgttattaagttatcagactcagactatatgagaaccttggaaaactgc
attcagttgggaactccagttctcctggaaaatgttggtgaagatttggatccctccttg
gagcctttgttactcagacaaacttttaaacaaggtggtattgactgcatcagacttggt
gaagtcattattgaatattcttttgattttaaattttatatcaccacaaaactgagaaat
ccacactacatgccagaactggctacaaaagtgtctttgctcaatttcatgataactccg
gaagggctggaagatcagctactaggcattgttgttgccaaggagagaccagagttagag
gaggagcgaaatgctctcattcttcagtccgcagctaacaagaagcagctcaaagacatc
gagacaaggattttagaaacactgtcatgttctgaagggaacattctggaagatgaaagt
gcgataaaagtcttagactctgccaaaatgatgtctaatgagatcacgaagaaacagcag
gttgcagaaaaaacagagctcaaaatagcagagtctcgagaaggctacagacccatcgcc
aaacactcgtcagtgttattcttcagcattgcagacctggccaacatcgatcctatgtac
cagtactccctcacctggtttgtgaacctgtacatcaactccattcacgacagcaacaga
tccaaaattttggaaaaacgcctgcgctatctaaatgaccacttcacatacaacttatat
tgtaacatatgccgatctctgttcgagaaagacaagctgctgttctcctttttattatgt
gctaatcttctcctggccaagaaagagattgaataccaggaactgatgtttcttctaact
ggaggagtaagtcttaagagtgctgaaaagaatcctgatccaaactggctacaggataaa
agctgggaggagatctgtcgagcaagtgaactcccagtcttccatggactcagggagcat
ttttgtaatcacatacgtgagtgggaggatatttacaacagtaaagagccgcacaatatg
aaacttccagaatcaatggacaagacgctgaacgagctgcagaaaataataattcttcgc
tgtctaaggcctgataagataaccccagctataacaaattatgtgactgacaaactaggg
aaaaaatttgtagagcctccaccatttgacttgacaaagagttatttggattcaaattgc
accatccctttaatttttgtgctgtctcctggagcagatccaatggccagcctgctgaaa
tttgcaaatgataaatctatgtctggaaataaatttcaagcgatttcactgggacaaggg
caaggaccagtagcaacaaaaatgattacagcagcaatagaagaaggaacttgggtttgt
ctacaaaactgtcatcttgctgtctcctggatgcccacattggaaaaaatctgtgaagat
ttttcacctgaaatctgcaatccaacctttaggctttggctcacaagctatccatctcca
aaattcccagtaacaattctacagaacggagtgaagatgaccaatgagcctcccactggc
ctccggctgaatctccttcaatcatatctctctgatccaatttctgatcctgagtttttc
aatggatgccccggcaaagaactggcatgggagaaattgctttttggagtttgctttttt
cacgcccttgttcaagagagaaagaaattcggtcctctaggctggaatattccatatgga
tttaatgagtctgacctacgcatcagtatccggcagctgcagttgtttataaacgaatat
gacacaatcccattcgaagctatctcttacctgactggggagtgtaactatggagggaga
gtgacagatgactgggaccggcgcctcctattaaccatgctggctgacttttacaactca
ttaatcattgaaaaccctcactacaagttctctcccagtggaaactactttgcgcctccc
aaaggcacttatgatgagtacattgaattcattaagaaacttccgtttactcaggaaccc
gagatatttggattacatgaaaatgttgatatctccaaagatcttcagcaaacgaaactc
ctttttgagtccttgctcctcacccagggtggcgtcaagcagacaggctcctcgggaagc
actgaccagatcctgttagaaattactgaggatatcctcacacagctcccaaacgatttt
gacattgaagcagcactaaggagttatcctgtgaggtacgaagagagcatgaatactgtg
ttagtgcaagaaatggaacgcttcaacaatttaattataactatccgtaatactctgcgg
gacctcaaaaaggcgattaaaggtgtagttgtgatggactctgcattggaagcactttct
ggcagcttgcttattggaaaggttccagaaatgtgggcacagcgatcgtacccaagtctg
aagccccttggaagttacatcacagatttcctgacccggctgaagtttctagaggattgg
ttcactatggggaaacccaatgtgttttggatctctggtttctttttcacccaagccttt
ttaactggagctatgcagaattatgccagaaaatacaccatccctattgatttgctaggc
tacgaatttgaggtgattccttccgataacgccaccaatccacctgaagacggcgtttat
attcatggactgtatcttgatggcgcacgctggaacaggaccagtggactgctggctgaa
caacatcccaaacttctgtttgacctgatgcccatcatatggataaaaccaaatgtaaag
actgagattgtgaagacagatgcctacgtctgtcccctctacaagacaagcgaacgtaaa
ggaactctttccacgacaggacactcgaccaactttgtcattgcaatgctattgaggaca
gaactgcctgctcaacactggatcaagcgcggggtggctctgctctgtcagttggataac
taa

KEGG   Rattus norvegicus (rat): 287845
Entry
287845            CDS       T01003                                 

Gene name
Dnah17
Definition
(RefSeq) dynein heavy chain 17, axonemal
  KO
K10408  dynein heavy chain, axonemal
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    287845 (Dnah17)
   05016 Huntington disease
    287845 (Dnah17)
   05022 Pathways of neurodegeneration - multiple diseases
    287845 (Dnah17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    287845 (Dnah17)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     287845 (Dnah17)
SSDB
Motif
Pfam: MT DHC_N1 AAA_6 DHC_N2 Dynein_C AAA_8 AAA_9 AAA_7 AAA_lid_11 AAA_lid_1 Dynein_heavy Dynein_AAA_lid AAA_5 AAA_16 AAA_22 AAA_30 ATP_bind_1 Sigma54_activat
Other DBs
NCBI-GeneID: 287845
NCBI-ProteinID: XP_038943439
RGD: 1563805
Ensembl: ENSRNOG00000003028
Position
10
AA seq 4459 aa
MPDPRIDYLETVSSALLKFKPDKWSKLVGAEENMALFTEFFDKTENPVLVMTLNPAGIII
PCLGFPESLKTKGVYFIRTKPENITKDNYKTRLIYGDISPTPVDQLIAVVEEVLYSLLNQ
NENMDGWPRVVSEDIVKQVHRLKNEMFVMGGKIKGKTLLPIPEHLGSLDGTLESMERIPS
SLDNSLLHSIETIIIDWSHQIRDVLSKDSAQALLDGLHPLPRVEFEFWDARLMNLQCIHE
QLNRPKVNKIVEILEKAKSCYWPALQNVYMNVTQGLKEANDIVLYLKPLRILLEEMEQAD
FTVLPSFIVKVLSTICFIWATSEHYNTPSRVIVILREFSNQIIEMTRTYLSPEEVLKGLQ
GEIEEVLGGISQSVGVLKELFHAYDFCCANMKLFFKDRPPVPWEFPSSLAFSRMNAFFHR
VQTIEDLYKTAIEFLKLEKIELGGVRGNILGNLVTQIYDEVFELVKVFAECKYDPLDPGD
SSFDDDYNDFETKIQDLDRRLATIFCQAFDDCNCIESSAKLLYMCGGLLERPLILVEVVP
RYSVMLEMFNTELDNAKLMYDAQMAASEDGQIPPIHKNMPPVAGQLKWSLELQERLEVSM
KYLKHIDHPVMSSVEAKLVYDKYDEMIGLLKGYREKKYQQWVEGVDQDCHFNLGQPLIQR
DPFSSLIQVNFSKALVAVLREVKYLNFQQQKEIPSSAEKLFSENEIFRKFVGNLELIVGW
YNEIKTTVMEVEFPLIKSELEEIDVKLMSAETTLFWNGENVMEYIQEMREILHNLQNRIQ
KTKQNIEGITQAMQEWSANPLFERKDNKKEALLDLDGRVANLNKRYAAVKDAGVRIQAMV
TENAELFKADTTSQPWKDYVNYIDAMVLDEFDRFIRKSLNYLMDNMTMDENIAPLFEIRM
ELDEDGLTFNPTLEMGDEDSFLSLIEGLINDLYNVARLIPRLAKGRINYKSDLEDITDLI
EMREELSSLVIGAMKVAEEYQDSFERYSYLWVDDLQEFMKNFLIFGHAPTPEELDTKIDD
TIPKTQPTLAQFQQQIDSYEKLYEEVSRCENTKVFHGWLQCDCRPFKQALLNTIKRWSLL
FKRYLSDHVINSLADLESFMGVTRTGLKKPLKEGDYDGLVEVMGHLMKVKERQVATDSMF
EPLKQTIELLKSYGEEMPEETYLKLQELPEQWTNTKKLAIQVKQNVAPLQANEVNILRRK
CQQFELKQHEFREKFRRDAPFTFSDPDPYKSLNKQQKSISAMEGVMEALCKSGSLFEVTV
PDYKQLKACHKEVRLLKELWDMIVMVNTSIDDWKTTKWKDINVEQMDIDCKKFAKDVRSL
DKEMKAWDAFVGLDNTVKNMITSLRAVSELQNPAIRERHWQQLMQATQVKFEMSEETTLA
DLLQLNLHKYEDEVRNIVDKAVKESGMEKVLKTLDSTWSTMEFEHELHPRTGTMLLKSDE
LLVETLEDNQVQLQNLMMSKYLSHFLKEVTSWQQKLSTADSVISIWFEVQRTWSHLESIF
IGSEDIRAQLPEDSRRFDSIDQEFKALMEDAVKTPNVVEATNKPGLYDKLERLKKSLAVC
EKALAEYLETKRLAFPRFYFVSSADLLDILSNGNDPVEVSRHLSKLFDSLCKLKFRLDAS
GNPIKVGLGMYSKEDEYMDFDKECDLSGQVEVWLNRVLDRMCATLRHEIPEAVVTYEEKP
REQWIFDYPAQVALTCTQIWWTTEVGLAFARLEEGYENAIKDYNKKQISQLNALITLLIG
NLSAGDRMKIMTICTIDVHARDVVAKMITAKVESSQAFTWQSQLRHRWDEEKKHCFANIC
DAQIQYSYEYLGNTPRLVITPLTDRCYITLTQSLHLIMGGAPAGPAGTGKTETTKDLGRA
LGTMVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVIAVQVKCVQDAI
RAKKKKFNFLGEMISLIPTVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEI
MLVAEGFLEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPTRAE
DQVLMRALRDFNIPKIVTDDLPVFMGLIGDLFPALDVPRKRDLNFEKIIKQSIVELKLQA
EDSFVLKVVQLEELLQVRHSVFVIGNAGSGKSQVLKSLNKTYQNMKRKPVAVDLDPKAVT
CDELFGIINPATREWKDGLFSTIMRDLANITHDGPKWIVLDGDIDPMWIESLNTVMDDNK
VLTLASNERIPLNRTMRLVFEISHLRTATPATVSRAGILYINPADLGWNPVVSSWIERRK
VQSEKANLIILFDKYLPTCLDKLRFGFKRITPVPEITVIQTILYLLECLLTEKNAPPDSP
KELYELYFVFACFWAFGGAMFQDQLIDYRVEFSKWWINEFKTIKLPSQGTIFDYYIDPET
KKFLPWTDKVPNFELDPDIPLQASLVHTTETIRIRYFMDLLMAKAWPVMLVGNAGTGKSV
LMGDKLENLSTDDYLVQAVPFNFYTTSAMLQGVLEKPLEKKSGRNYGPPGTKKLIYFIDD
MNMPEVDKYGTVAPHTLIRQHMDHRHWYDRQKLTLKDVHNCQYVACMNPTSGSFTIDPRL
QRHFCVFAVSFPGHEALITIYNTILAQHLSYRSAPSVIQRLCSHLVTAALALHQKVAATF
LPTAIKFHYIFNLRDLSNIFQGILFSTLEILRTPLDIVRLWLHEAERVYGDKMVDEKDQE
TLRRVTMASTKKFFDDLGEEHLFAKPNIFCHFTQGIGDPKYFPVTDVAHLNKLLKDVLDS
YNEVNAVMNLVLFEDAVAHICRINRILESPRGNALLVGVGGSGKQSLSRLAAYISALDVF
QITLKKGYAIPDLKMDLAAQYIKSAVKNVPSVFLMTDSQVAEEQFLVLINDLLASGEIPG
LFGDDDLENIISSMRPQVKSLGMTDTREACWKFFIEKVRKQLKVILCFSPVGSVLRVRAR
KFPAVVNCTAIDWFHEWPEDALVSVSARFLQETQGIQPEVKTSISLFMSYVHTTVNEMSK
TYLATERRYNYTTPKTFLEQIKLYQNLLAKKRMELVAKIERLENGLMKLQSTASQVDDLK
AKLAVQEAELKQKNENADKLIQVVGVETEKVSKEKAIADEEEIKVEVINKNVTEKQKACE
TDLAKAEPALLAAQEALDTLNKNNLTELKSFGSPPDAVVNVTAAVMILTAPGGKIPKDKS
WKAAKIMMGKVDTFLDSLKRFDKEHIPEACLKAFKPYQGNPTFDPEFIRSKSTAAAGLCS
WCINIVRFYEVYCDVAPKRQALEEANAELAEAQDKLSRIKNKIAELNANLNNLTSAFEKA
TAEKIKCQQEADATNRVISLANRLVGGLASENVRWAESVENFRSQGVTLCGDVLLISAFV
SYVGYFTKKYRNELMEKFWIPYVNNLKVPIPITEGLDPLTLLTDDADVATWNNQGLPSDR
MSTENATILCNTERWPLIVDAQLQGIKWIKNKYGSELKAIRLGQKSYLDIIEQAISEGDT
LLIENIGETVDPVLDPLLGRNTIKKGRFIKIGDKEVEYHPSFRLILHTKYFNPHYKPEMQ
AQCTLINFLVTRDGLEDQLLAAVVAKERPDLEQLKANLTKSQNEFKIVLKELEDSLLARL
SAASGNFLGDTALVENLETTKHTANEIEEKVQEAKITETKINEARENYRPAAARASLLYF
ILNDLNKINPIYQFSLKAFNVVFEKAIQKTPPAEEVRQRVINLTDEITYSVYMYTARGLF
ERDKLIFLAQVTFQVLSMKKELNPVELDFLLRFPFKAGVVSPVDFLQHQSWGGIKALSEM
DEFKNLDSDIEGSAKRWKKLVESEAPEKEIFPKEWKNKTALQKLCMVRCMRPDRMTYAVK
NFVEEKMGSKFVEGRSVEFSKSYEESSPSTPIFFILSPGVDPLKDVEALGKKLGFTIDNG
KLHNVSLGQGQEVVAEDALDVAAEKGHWVILQNIHLVARWLSILDKKVERYSSGSHEDYR
VFISAEPAPSVETHIIPQGILENAIKITNEPPTGMYANLHKALDLFTQDTLEMCTKEIEF
KCILFALCYFHAVVAERRKFGAQGWNRSYPFNNGDLTISINVLYNYLEANPKVPWDDLRY
LFGEIMYGGHITDDWDRRLCRTYLIEFIRVEMLEGEVLLAPGFQIPPNLDYKGYHEYIDE
NLPPESPYLYGLHPNAEIGFLTVTSEKLFRTVLEMQPKETDSGAGTGVSREEKVKAVLDD
ILEKIPETFNMAEIMAKAAEKTPYVVVAFQECERMNILTNEMRRSLKELNLGLKGELTIT
TDMEDLSTALFYDTVPETWVARAYPSMMGLAAWYSDLLQRIRELESWTTDFALPTTVWLA
GFFNPQSFLTAIMQSMARKNEWPLDKMCLSVEVTKKTREDMTAPPREGSYVYGLFMEGAR
WDTQTGVIAEAKLKDLTPVMPVIFIKAIPVDRMETKNIYECPVYKTRIRGPTYVWTFNLK
TKEKAAKWILAAVALLLQV
NT seq 13380 nt   +upstreamnt  +downstreamnt
atgccagaccccagaattgattacctggagacagtgtcttctgctctcctcaagttcaag
ccagacaaatggagcaaactggtcggagccgaggagaacatggccctgttcacggaattc
ttcgacaaaactgaaaaccctgtcctggtgatgacactcaaccctgctggtataataatt
ccgtgcctgggtttcccagagtccctcaagaccaaaggagtttacttcatcaggacgaag
ccggagaacatcaccaaggacaactacaagacccgtctcatctacggggacatcagtccc
acccccgtagaccagttgattgcagtagtggaggaggtcctctactctctgctaaaccag
aatgagaacatggatggctggccccgggtggtgtcagaagacattgtcaagcaggtccac
aggctgaagaacgagatgttcgtgatgggaggcaagatcaaggggaaaaccctgctgcct
atccccgagcacctggggagcctggacggcacgctggagtccatggagaggatcccctcc
tccctggacaattcgctcctacactccatcgagaccatcatcatagattggtcccatcaa
atccgggatgtgctgagcaaggattcggctcaggccctgctggatggcctgcatcctctg
ccccgtgtggaatttgagttctgggacgcccggctcatgaacctgcagtgcatccacgag
cagctaaacaggcccaaggtgaacaagatagttgagatcctggaaaaggccaaaagctgc
tactggccagccctacagaacgtctacatgaatgtcacccaagggctaaaggaagccaat
gacattgtcctgtatctgaagcctctgcgtatcctgttggaggagatggagcaggcagac
ttcacagtgctccccagtttcatcgtcaaggtgctaagcacgatctgtttcatctgggcc
acctccgagcactacaacacaccctccagggtcatcgtcatccttcgggagttcagcaac
cagatcatcgagatgactagaacctacctgagcccagaggaggtgctgaagggcttgcag
ggtgagatagaggaggtccttggcggcatctcccagtcggtgggcgtcctcaaggagctc
ttccacgcctacgacttctgctgcgcaaacatgaagctcttctttaaggacaggccgccc
gtgccgtgggaattcccttcatccctcgccttctcccgcatgaatgccttcttccaccgc
gtgcagaccattgaggacctttacaaaacggccattgagttcctgaagctggagaagatt
gagctgggaggcgtgcggggcaacatcctggggaacctggtgacccagatctacgacgag
gtcttcgaactggtgaaggtctttgctgagtgcaaatatgaccctctggaccccggagac
tcgagctttgacgatgactacaatgactttgagactaagatccaagacctggacaggagg
ctggccaccatcttctgccaagcctttgacgactgcaattgcattgagtcgtccgcaaag
ctcctgtacatgtgcgggggcctcctggaacgacccctgattcttgtggaggtggtaccc
aggtactcggtcatgctggagatgttcaacactgagctggacaacgccaagctcatgtac
gatgcccagatggcggcctccgaagacggccagataccgcccatccacaaaaacatgccc
cctgtggccgggcagctcaagtggagcctggagctgcaggagaggctggaggtgtccatg
aagtacttgaagcacatcgaccacccggtcatgtccagtgtggaggctaagctggtctac
gacaagtacgacgagatgatagggttgctgaaaggctaccgggagaagaaataccagcag
tgggtggagggcgtggaccaggactgccacttcaacctggggcagccactcatccagcgc
gaccccttctccagcctcatccaagtcaactttagcaaagcgttggtggcagtcctgaga
gaagtgaagtatttgaacttccagcagcagaaagagattccaagcagtgcggagaagctc
ttctcggagaatgaaatcttccggaagttcgtgggcaacctagagctcatcgttggctgg
tacaacgagataaagactaccgtgatggaggtggagtttccactgatcaagtcagaactg
gaagaaattgatgtcaaattgatgagcgctgagacgacgttgttctggaatggcgaaaat
gtgatggagtacatccaggagatgcgggagatactgcacaatctgcagaaccggatccag
aaaaccaaacaaaacatagaaggaatcacgcaggccatgcaggagtggtcagccaacccc
ctgtttgaaaggaaggacaacaagaaggaggccctgctggacctggacggcagggtggcc
aacctgaacaagcgctacgctgctgtcaaggacgctggtgtgagaatccaagccatggtt
acggaaaatgcagaactgttcaaagcagatacaaccagccagccctggaaggattatgtc
aactatattgacgccatggtcttagatgagtttgaccgcttcatccgcaaatctctaaat
tacttaatggacaacatgactatggatgagaatatcgctcccctgtttgagatacgtatg
gagctggatgaagatgggctgaccttcaatccaactctggagatgggtgacgaggacagc
ttcctgtcactgatcgagggcttgatcaatgacctctacaatgtggccaggctcatccct
cgcctggccaagggcagaataaactacaagtcagacctggaggatatcacagacctcatt
gagatgcgggaagaattgtccagcctggtcatcggggccatgaaggtggccgaggagtac
caggactccttcgagaggtactcctacctctgggtggatgaccttcaagagtttatgaag
aacttcctcatcttcgggcacgcgcccacccccgaggagctggacaccaagattgacgac
accatccccaagacacaacccaccctggctcagttccagcagcagattgactcctatgag
aagctgtacgaggaggtgtccaggtgcgagaacaccaaggttttccacggctggctgcag
tgcgactgccgccccttcaagcaggccttgctcaacaccatcaagcgctggagtctcctg
ttcaaacgatatctgagcgaccatgtgatcaacagccttgccgatctggaaagcttcatg
ggtgtcacccggactggcctaaagaagccactcaaggagggagactatgacggactggtg
gaggttatggggcacctaatgaaggtcaaggagaggcaggtggccaccgacagcatgttc
gaacccctgaagcaaaccatcgaactgctcaagtcctacggggaggagatgccggaggag
acctacttgaagctgcaggagcttccagagcagtggaccaacaccaagaaactggccatt
caggtgaagcagaatgtggcgccactccaggccaacgaggttaacatcctgaggcgcaag
tgtcagcagtttgagctcaagcagcacgagttcagagagaagttcagacgtgatgccccc
ttcaccttcagcgaccccgacccctacaagtccctgaataagcaacaaaagagcatctcg
gccatggagggtgtgatggaggcgctgtgcaagtctggcagcctgttcgaggtcacagtg
ccagactacaagcagctgaaggcttgccacaaggaggtccgcctgctgaaggagctctgg
gacatgatcgtcatggtcaacaccagcatcgatgactggaagaccaccaagtggaaggac
atcaatgtggagcagatggatattgactgtaaaaagtttgccaaggacgtgaggtctttg
gacaaggagatgaaagcctgggatgcttttgtgggactggacaacaccgtgaaaaacatg
atcacatccctgcgcgctgtgagcgagctgcagaaccccgccatccgcgaacgccactgg
caacaactcatgcaggccactcaggtaaagtttgaaatgtccgaagaaaccacactggca
gatttgctccagctgaacctccacaagtatgaggatgaggtccgcaacattgtagacaag
gccgtaaaggagtctgggatggagaaggttctgaaaactctggatagcacctggagcacc
atggaatttgagcacgagttacacccacggacaggcaccatgttgctcaagtccgacgaa
ctgctggtggagaccctggaggacaaccaggtgcagctgcagaacctgatgatgtccaag
tacctgtcccacttcctgaaggaggtgaccagctggcagcagaagttgtccacagcggac
tccgtcatctccatctggtttgaggtccaaaggacctggagccacctggagagcatcttc
attggctccgaagacatcagagctcagctaccagaggactccaggcgcttcgactccatc
gaccaggaattcaaggccctgatggaggatgctgtgaaaacaccaaacgtggtggaagcc
accaacaagccgggcctctacgacaaactagagaggctgaagaagagcttggctgtgtgt
gaaaaggcgttggctgaatatctggagaccaagaggctggcgttcccacggttctacttc
gtctcctccgctgacctgctggacattctctccaacggaaacgatcccgtggaggtgagc
cgccacctgtccaaactcttcgacagtctgtgtaagctcaagttccgccttgatgctagc
ggaaacccgatcaaggtcgggctggggatgtacagcaaggaagacgaatacatggatttc
gataaggagtgtgacctctcggggcaggtggaagtgtggctgaatcgagtgctggaccga
atgtgtgccacgttgcgccacgaaatcccagaagctgtggtgacttacgaggagaagccc
agggagcaatggatctttgactacccggcccaggtggcgctgacatgcacgcagatctgg
tggacgactgaggtgggcctggcgttcgcaaggctggaggaaggatatgaaaacgccatc
aaagactacaacaaaaagcagatcagccagctgaatgcgctcattactctgctcatcggg
aacctcagcgctggtgacaggatgaagattatgaccatctgcaccatcgatgtgcatgcc
cgagacgtggtggccaagatgatcaccgctaaggtggagagctcccaggccttcacctgg
cagtcacagcttcgacaccgctgggacgaggaaaagaaacattgcttcgccaatatctgt
gacgcccagatccaatactcctatgagtacctgggcaacacgcctcggctggtcatcacc
cccctcacagacaggtgctacatcacactcacacagtccctccacctgatcatgggcgga
gcccctgcaggccctgctggcacgggcaagacggagacaaccaaggacctgggcagagcc
ctaggcaccatggtgtacgtcttcaactgctctgagcagatggactacaagtcctgtgga
aacatctacaagggtctggcacagacaggagcctggggttgctttgatgagtttaaccgg
atctcagtggaggtcttgtctgtgattgctgtacaggtaaagtgtgtccaagatgcaatt
cgggccaagaaaaagaagtttaacttcctgggagaaatgataagtctcatccccactgtg
ggcatcttcatcaccatgaaccctggctacgcgggacgcacggaactgccggagaacttg
aaggctctattcaggccctgcgctatggtggtccccgactttgagctgatctgtgagatt
atgctggtggctgagggcttcctggaagctcgcctcctggcccggaagttcatcaccctc
tacaccctgtgcaaagagctgctctcaaagcaggatcattatgactggggccttcgggcc
atcaagtctgtgctggtggtagctggctccttgaagaggggagaccctacccgggcagag
gaccaggtgctcatgagggcactgcgagacttcaacatccccaagatcgtgactgatgac
ctgcctgtgttcatgggactgatcggtgacctcttcccagctctggacgtgccccgaaag
cgagacctgaattttgagaagatcatcaagcagagcatcgtggagctcaagctgcaggca
gaagatagctttgtgctgaaagtcgtgcagctggaggagctgcttcaagttcgacactca
gtattcgtcattgggaacgcaggcagcggcaaatcccaggtcctcaaatccctcaacaag
acctaccagaacatgaagaggaagcctgtggcagtggacctggacccaaaggctgtcacc
tgtgatgagctgtttggtatcatcaacccggcgaccagggagtggaaagatggcctgttc
tcaaccatcatgcgggacctggccaacatcacgcacgacgggcccaagtggattgtcctg
gatggagacatagaccccatgtggattgagtctctcaacacagtcatggatgacaacaag
gtcctcaccctggccagcaatgagcggattcccttgaatcgcaccatgaggctggtgttt
gagatcagtcacctaaggacagccaccccggccaccgtctctagggccggcatactctac
attaaccctgccgatctgggatggaacccggtggtgagcagctggatagagaggcgcaag
gtgcagtcggagaaagccaacctgatcatcctcttcgacaagtacctgcccacgtgcctg
gacaagctgcgcttcggtttcaagaggatcacccctgtgccggaaatcaccgtcatccag
accatcctgtacctgctggagtgtctgctcacagagaagaatgccccgcccgactccccc
aaggagctgtacgagctgtacttcgtgttcgcctgcttctgggctttcggaggcgccatg
ttccaggaccagctcattgattatcgagtggagttcagcaagtggtggatcaacgaattt
aaaacaatcaagttaccctcgcaggggaccatttttgactactacattgacccggaaaca
aagaaattcctgccctggacagataaagtgcctaactttgagctggatcccgacatcccc
ctgcaggcctctctagtccacaccacggaaaccatccgcatccgatacttcatggacctg
ctcatggcgaaggcgtggcccgtgatgctggtgggcaatgcgggcactggcaagtcggtg
ctgatgggggacaagctggagaacctcagtaccgacgattacctggtgcaggctgtgccc
ttcaacttctacacgacctcagccatgctgcagggggtgctggagaagcctctggaaaag
aagtcagggaggaactatggcccgccaggcactaagaagctaatctactttatcgatgac
atgaacatgccagaagtggacaagtacggcacggtggccccacacaccctcatccgccag
cacatggaccacagacactggtatgacaggcagaaactgacactgaaggacgtgcacaac
tgtcagtacgtggcctgcatgaaccctacttctggctccttcaccattgaccccagacta
cagcgtcacttctgcgtgtttgcggtgagcttccccggccatgaggccctcatcaccatc
tacaacacaattctggcacagcacctgtcataccgctcagccccctcggtgatccagcgg
ctgtgcagccatctggtgaccgcagccctggccttgcaccagaaagtcgctgcaacgttc
cttcccacggccattaagtttcattacatcttcaacctcagggacctctccaacatattc
cagggtatcttgttctccacgttagagattctgagaaccccgctggacatcgtccgcctc
tggctgcacgaggctgagcgggtgtacggggacaagatggtggatgagaaagaccaggag
acgttgcgcagggtcaccatggcatccaccaagaaattcttcgatgacctcggggaagag
cacctcttcgccaaacccaacatcttctgccactttacacaagggatcggggaccccaag
tacttccccgtcacggacgtggcgcacctgaacaagcttctcaaagacgtcctggacagt
tacaacgaagtcaacgcggtcatgaacctggtgctgttcgaggacgccgtggcacacatc
tgcaggatcaaccgtatcctggagtcccctcggggaaacgccctgttggtgggcgtgggt
ggcagtggaaaacagagcctgtcccgcctagccgcctacatcagcgccctggacgtcttc
cagatcacactcaagaaaggctatgcgatcccagacctcaagatggacctggctgcccag
tacatcaagtccgcggtgaagaacgtgccctcagtattcctgatgacagactcccaggtg
gctgaggagcagttcctggtgctgatcaacgacttgctagcctcgggggaaatcccaggc
ttgtttggggacgacgaccttgaaaatatcatctcctccatgcggccacaggtgaagtct
ctcggtatgaccgacacccgagaggcatgctggaaattcttcattgagaaagtgcggaag
cagctcaaggtgatcctgtgtttctcccccgtgggctctgtcctgcgtgtgcgagcccgg
aagttccctgccgtggtcaactgcacagccatcgactggttccatgagtggccagaagac
gctctggtgtctgtcagcgcacgcttcctgcaggagacacagggcatccagcctgaagtg
aagacctccatcagcctcttcatgtcctacgtgcacaccacagtcaatgagatgtccaag
acgtacctggcgacagagaggcgctacaactacaccacgcccaagaccttcctggagcag
atcaaactctaccagaacctgctggccaagaagaggatggagctggtcgccaagattgag
cggctagagaatggcctcatgaagctgcagagtacggcctctcaggtggatgacctaaag
gccaagctggcggttcaggaggccgagctgaagcagaagaacgaaaacgcagacaaactg
atccaggtggtgggcgtggagactgagaaggttagcaaggagaaggccattgccgacgag
gaggagatcaaggtggaggtcatcaataagaacgttactgagaaacagaaagcctgtgaa
acagacctggccaaggcagaaccagccctcttggccgcacaagaggccctggataccctg
aacaagaacaacctgacagagctgaagtccttcggatccccaccagatgccgtggtcaac
gtcacagccgctgtcatgatcctgacggcgcctgggggcaagatccccaaggacaagagc
tggaaggctgccaagatcatgatgggcaaggtggacacattcctcgactcgctgaagagg
ttcgacaaggaacacatcccggaagcctgcctaaaggccttcaagccgtatcaaggcaac
cccacatttgaccctgagttcattcgctccaagtccacagctgccgcgggcctgtgctcc
tggtgcatcaacatcgtgcgcttctatgaggtctactgcgatgtggcgcccaaaaggcaa
gccctggaggaggccaatgcagagctggctgaagcacaggacaaactgtcccggatcaaa
aacaagattgctgaactcaatgccaacctgaacaacctcacctccgcgtttgagaaagca
acagctgagaaaatcaagtgtcagcaggaggcggatgccaccaacagggtgatctcattg
gctaacagacttgtgggaggactggcttcagaaaacgtgcgctgggccgagtcggtggag
aacttccggagccagggcgttaccctgtgcggggatgtgctgctcatctctgcctttgtt
tcctacgtgggctacttcaccaagaagtaccggaacgagctgatggagaaattctggatc
ccttacgtcaataacttaaaggttccgatccccatcacggaaggcctggatcccttgact
ctgctgaccgatgatgcagacgtggccacctggaacaaccagggtctgcccagcgaccgc
atgtccactgagaatgccaccatcttatgcaacacggagcgctggccgctgattgtggat
gcccagcttcaaggcatcaagtggatcaaaaacaaatacggcagtgaactaaaggccatc
cgtctggggcagaagagctacctggacatcattgagcaggccatctcagaaggtgacacc
ttactcatcgagaacattggcgagactgtagaccccgtgctcgatccattgctaggccgg
aacaccatcaaaaaggggaggttcattaagatcggcgacaaggaggtggagtaccacccc
agcttccgcctgatccttcacaccaagtacttcaacccccactacaaacccgagatgcag
gcacagtgcacgctcatcaacttcctggtcaccagagacggcctcgaggaccagctcctg
gccgctgtggtggccaaagagcgcccggatctggaacagctcaaggcaaacctcaccaaa
tctcagaacgagttcaagatcgtgctaaaggaactggaagactccctactggctcggctg
tcagccgcgtcggggaactttctgggagacactgccctggtggaaaacctagagaccacc
aagcacacagccaatgaaattgaggagaaggtccaagaggcaaaaatcacagaaacaaag
atcaatgaggcgcgagagaactaccgcccagcggccgcaagggcctccctgctctacttt
atcctgaacgacctcaacaaaatcaaccccatctaccagttctctctcaaggccttcaat
gtggtgtttgagaaagccatccagaagaccccgcccgccgaggaggtgaggcagcgcgtg
ataaacctgacggacgagatcacctactctgtgtacatgtacacggcacgcgggctcttc
gagcgggacaagctcatcttcttggctcaagtcaccttccaggtcctttccatgaagaag
gagctgaatcctgtggaactggactttctattgcggttccccttcaaggcaggcgttgtg
tcacctgtggacttcctgcaacaccagagctggggcgggatcaaggccctgtcggagatg
gacgagttcaaaaacctggacagtgacatcgagggctccgccaagcggtggaaaaagctg
gtagagtcggaagcgccggagaaggagatcttccccaaggaatggaagaataagactgcc
ctgcagaagctgtgcatggtgcgctgtatgaggccggaccgcatgacctacgccgtcaag
aattttgtggaagagaagatgggtagtaagtttgtagaaggccggagcgtggagttctcc
aagtcctacgaagagagcagcccctccacaccaatcttcttcatcctgtcccccggggtc
gaccccctcaaagacgtggaggccctcgggaaaaaactgggatttaccatagacaatggg
aaactccataacgtgtccctggggcaaggacaagaggtggtggccgaggatgcgctggac
gtggctgccgagaaaggacactgggtcattctgcagaacattcacctggtggcgagatgg
ctgagtatcctggacaagaaggtggaacgctacagctcaggtagccacgaggactaccgg
gtgttcatcagcgcagagcctgctccctccgtggagacacacatcatcccccagggcatc
ctggaaaacgccatcaaaatcaccaacgagcctcccacgggcatgtatgccaacctgcac
aaggcgctggaccttttcactcaggacaccctggagatgtgcaccaaggagattgagttc
aagtgcatcctcttcgccttgtgctacttccacgccgtggtcgccgagaggcgcaagttt
ggtgcccagggctggaaccggtcgtaccccttcaacaatggggacctcaccatctccatc
aacgtgctctacaattacctggaagccaaccccaaggtgccctgggatgatctccgctac
ctttttggtgagatcatgtacggaggccacatcactgatgactgggaccgccggctgtgc
aggacctacctgatagagttcatccgtgtggagatgctagaaggggaggtgctgctggcc
cccgggtttcagatccccccaaatctggactataagggttaccatgagtacatcgatgag
aacctaccccccgagagtccttacctgtacggcctgcaccccaacgcagagatcggtttc
ctgacagtcacctcggagaagctgttccgaactgtcctagagatgcagcccaaagagaca
gactcaggagctggcacgggggtgtcacgggaggaaaaggtgaaggctgtgctggatgac
atcctcgagaagataccagagacgttcaacatggctgagatcatggccaaagctgccgag
aagacaccctacgtggtcgttgcctttcaagagtgtgagaggatgaacatcctcaccaat
gagatgcggcgctcgctgaaggagctgaacctgggactaaagggtgagctgacgatcaca
accgacatggaagacctgtccaccgctctgttctatgacactgtgcctgagacctgggtg
gcccgggcctacccctccatgatgggtttggcagcctggtattctgacctgctgcaacgt
atcagggagcttgaatcctggacaacagacttcgccctgcccaccactgtgtggctggct
gggttcttcaacccacagtcgtttctcactgccatcatgcagtccatggccaggaaaaac
gagtggcccctggataagatgtgcctgtctgtggaggtgaccaagaagacccgggaagac
atgactgcccctcctcgagagggctcctacgtgtacgggctcttcatggaaggagctcgc
tgggacacccagaccggagtcattgctgaagcaaagctgaaggatctgaccccagtcatg
cccgtcatcttcatcaaggccattcctgtggaccgaatggagaccaagaacatctatgaa
tgccccgtgtacaagacacgtatccgaggacccacctatgtctggacttttaacctgaag
accaaagagaaggcggccaagtggatcctggcagccgtggcgctgcttctgcaggtgtag

KEGG   Rattus norvegicus (rat): 294854
Entry
294854            CDS       T01003                                 

Gene name
Dnah5
Definition
(RefSeq) dynein heavy chain 5, axonemal isoform X1
  KO
K10408  dynein heavy chain, axonemal
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    294854 (Dnah5)
   05016 Huntington disease
    294854 (Dnah5)
   05022 Pathways of neurodegeneration - multiple diseases
    294854 (Dnah5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    294854 (Dnah5)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     294854 (Dnah5)
SSDB
Motif
Pfam: DHC_N1 AAA_6 DHC_N2 Dynein_C AAA_8 AAA_9 AAA_7 AAA_lid_11 MT Dynein_heavy AAA_5 AAA_lid_1 Dynein_AAA_lid FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 294854
NCBI-ProteinID: XP_008759046
RGD: 1560828
Ensembl: ENSRNOG00000048363
Position
2
AA seq 4621 aa
MFRIGRRQLWKQSVTRVLTQRLKEEKEAKRARLDGRHDYLFAIVASCLDLNKPEVEDALL
EGNQIERIDQLFAVGGLRHLMFYYQDVEGAEAGQFGSSGGVNPASGKMKKPKVFVTEGKD
VALMGACVFFTRADPSKAITAENIHREVSFNTLDTADGGLLNSVRRLLSDIFIPALRASS
HGWGELEGLQDASSIQQEFLSSLEGFVGILSGAQNSLKEKVNLQKCDIVELKSLKEPMDY
LALASNPETVEKVECCMRVWIKQMEQILAENNQLRKEADDVGPRAELEHWKKRLSKFNYL
LDQLKSPDVKAVLAMLAAAKSKLLKVWRDADIRVTDAANEAKDNVKYLYTLEKCCDPLYS
SDPVTMVDAIPTLINAIKMIYSISHYYNTSERITSLFVKVTNQMISACKAHITNNGTATI
WSQPQDIVMQKIAAAIKLKQGYQCCFQETKQKLKQNPSEKQFDFSEMYIFGKFETFHQRL
AKIMDIFTTFKTYSVLQDSKIEGLEDMVTKYQDVVAGIKKKEYNFLDQRKMDFDQDYDEF
CKQTNELHSELQRFMDTTFEKIQSTRQALSTLKKFERLNIPNLGIEAKYQIVFQNFGTDI
DMISKLYTKQKYDPPLARDQPPIAGKILWARQLFHRLEQPMQLFQQHPFVLRTVEAKPVI
RSYNRIAKVLLEFEVLYHRAWLQQIEEIHVGLEASLLVKAPGTGQLFVNFDPQILILFRE
TQCMSQMGLPVSPFAAALFEKRDMYKKNFSDMKMMLSEYQRVKLKMPPAIEQLMLPHLAR
VDEALQPGLAVLTWTSLNIGTYLENAFEKIKDLELLLDRINDLIEFRIHAILEEMSSVAL
CQLPQDDPLTCEEFLQMTKDLCVNGAQKLHFKSSLVEEAVNELINMLLDVDVLPEEASEK
VRHENASPNGDTSGGGEGCAEALASSFNAGTSSLPLTTIARKKKEMEVLEEARELLSYFN
HQNTDALLKVTRNTLEAIRRRIHFSHMINFRDSKGASKVKQNHLPIFRASVTLAIPNISM
TPALEDIQQTLNKAVECIISVPKGVRQWSSELLSKRKMRERKMAAVQSNEDSDSDTEVEE
SELQETLELASVNLPIPVQTQNYYKNISDNKEIVKLVSVLSTVISSTKKEVITSMDRFKC
YNHIWQKEKEDTIMTFIAQNPLLSEFESRILYFQSLEQEINAEPEYICVGSIALYTADLK
FSLTAETKAWMMVLGRHCNRKYRSEMENIFTVVEEFQKKLNRPIKDLDDIRIAMAALKEI
REQQISTDFQVGPIEESYALLNKYGLLVAKEEMDKVDTLRYAWEKLLARASDVQNELGAL
QPSFRKELISTVEVFLQDCQQFYLDYDLNGPMVSGLKPQEASDRLIIFQNQFDNIYRKYI
TYTGGEELFGLPVTQYPQLLEIKKQLNLLQKIYSLYNNVIETVNSYQDTLWSEVNIEKIN
SELLEFQNRCRKLPRALKDWQAFLDMKKTIDDFSECCPLLEYMASNAMVERHWQRITTLT
GHSLDVGNETFKLRNIMEVPLLKYKEEIEDICISAVKERDIEQKLKQVINEWDNKTLTFS
SFKTRGELLLRGDSTSEVIASMEDSLMLLGSLLSNRYNMPFKAQIQNWVQCLSNSTDIIE
NWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEIPNVVQCCVGDE
TMGQLLPHLLDQLEICQKSLTGYLEKKRLCFPRFFFVSDPALLEILGQASDSHTIQAHLL
NVFDNIKTVKFHDKIYDRILSISSREGETIELDKPVMAEGNVEVWLNSLLEESQSSLHLV
IRQAAANIQESGFQLIEFLSSFPAQVGLLGIQMLWTRDSEEALQNAKFDKKIMQKTNQSF
LELLNMLIEMTTKDLSSMERVKYETLITIHVHQRDIFDDLCHMHVKSPTDFEWLKQCRFY
FKEDSDKTMIHITDVAFTYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAG
TGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLS
VAAQQISIILTCKKEHKKSFIFTDGDNVTMNPEFGLFLTMNPGYAGRQELPENLKINFRS
VAMMVPDRQIIIRVKLASCGFIDNVVLARKFFTLYQLCEEQLSKQVHYDFGLRNILSVLR
TLGAAKRASHTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPNILLDKAGYPELE
TAISKQVEEAGLINHPPWKLKVIQLFETQRVRHGMMTLGPSGSGKTSCIHTLMKAMTDCG
KPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDA
IWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVL
DWSPILEGFLKRRSPQEAEILRQLYAETFPDLYRFSIQNLEFKMEILEAFVITQSTHMLQ
GLIPTKEQAGDVDPEHLGRLFVFAMMWSVGAVLELEGRRRMELWLRSREGPTLHLPQLTD
PGDTMFDYYVAPDGTWRHWSMCIPEYVYPPDTTPEYGSILVPNVDNVRTDFLIKTIAKQG
KAVLLIGEQGTAKTVIIKGFMSKFDPESHTVKNLNFSSATTPLMFQRTIESYVDKRMGTT
YGPPAGKKMAVFIDDLNMPVINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTSIVDIQFL
AAMIHPGGGRNDIPQRLKRQFSIFNCTLPSDASMDKIFGVIGEGYYCAQRGFSKEVQDAV
IKLVPLTRRLWQMTKLKMLPTPAKFHYVFNLRDLSRIWQGMLNITSEVIKDTDELLRLWK
HECKRVIADRFSMSSDVTWFDKAVVSLVEEEFGEEKTPVVDCGVDAYFVDFLRDAPEATG
ETPEETDAEMPKLYEPIASLNHLQERLSVFLQLYNESIRGTGMDMVFFRDAMVHLVKISR
VIRTPRGNALLVGVGGSGKQSLTRLASFIAGYTSFQITLTRSYNTSNLMEDLKVLYRTAG
QQGKGITFIFTDNEIKEESFLEYMNNVLSSGEVSNLFARDEIDEINSDLTSIMKKEHPKR
PPTNDNLYEYFMSRVRGNLHIVLCFSPVGEKFRNRALKFPALISGCTIDWFSRWPKDALV
AVSEHFLSSYNIDCTAEIKKELVQCMGSFQDGVAEKCADYFQRFRRSTHVTPKSYLSFIQ
GYKFIYEEKHVEVQSLANRMNTGLEKLKEASESVAALSQELAVKEKELQVANEKADMVLK
EVTMKAQAAEKVKAEVQKVKDKAQAIVDSISKDKAIAEEKLEAAKPALEEAEAALQTIKP
SDIATVRTLGRPPHLIMRIMDCVLLLFHRRVNAVKIDLDKSCTVPSWQESLKLMTAGNFL
QNLQQFPKDTINEEVIEFLSPYFEMSDYNIETAKRVCGNVAGLCSWTKAMASFFSINKEV
LPLKANLIVQENRHALAMQDLQKAQAELDDKQAELDVVQAEYEQAMTEKQTLLEDADRCR
HKMQTASTLISGLAGEKERWTEQSKEFAAQIKRLVGDVLLATAFLSYSGPFNQEFRDLLL
NDWKKEMKARKIPFGNDLNLNEMLIDAPTISEWNLQGLPNDDLSIQNGIIVTKASRSPLL
IDPQTQGKIWIRNKESQNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNV
LEKNFIKTGSTFKVKVGDKEVDVMDGFKLYITTKLPNPAYTPEISARTAIIDFTVTVKGL
EDQLLGRVILTEKQELEKERTHLLEEVTANKRRTKELEDNLLYRLTSTQGSLVEDESLIV
VLSNTKKTAEEVTQKLEISGETEIQINSAREEYRPVATRGSILYFLITEMRLVNEMYQTS
LRQFLGLFDLSLARSVKSPITSKRIGNIIEHMTYEVFKYAVQGLYEEHKFLFTLLLTLKI
DIQRNLVKHEEFLTLIKGGASLDLKACPHKPSKWILDMTWLNLVELSKLKQFSDILDQIS
RNEKLWRIWFDKENPEEEPLPNAYDKSLDCFRRLLLIRSWCPDRTIAQARKYIMDSMGEN
YAEGVILDLEKTWEESDPRTPLICLLSMGSDPTDSIIALGKRLKIETRYVSMGQGQEVHA
RKLLHQTMANGGWVLLQNCHLGLDFLDELMDVVTETETVHDTFRLWITTEVHKQFPITLL
QMSIKFANEPPQGLRAGLRRTYGGVSQDLLDVSVGAQWKPMLYAVAFLHSTVQERRKFGP
LGWNIPYEFNQADFNATVQFIQNHLDDMDIKKGVSWTTVRYMIGEIQYGGRVTDDYDKRL
LNTFAKVWFSENMFGPDFTFYQGYNIPKCSTVDGYLQYIQSLPAYDSPEVFGLHPNADIT
YQSKLAKDVLDTILGIQPKDSSGGGDETREAVVARLADDMLEKLPEDYSPFEVKERLQKM
GPFQPMNIFLRQEIDRMQRVLSLVRSTLTELKLAVDGTIIMSDNLRDALDCMFDARIPAR
WKKASWVSSTLGFWFTELLERNCQFTSWVSNGRPHCFWMTGFFNPQGFLTAMRQEITRAN
KGWALDNMVLCNEVTKFMKDDISAPPTEGVYVYGLYLEGAGWDKRNMKLIESKPKVLFEL
MPVIRIFAENNTARDPRLYCCPIYKKPVRTDLNYIAAVDLKTAQAPEHWILRGVALLCDV
K
NT seq 13866 nt   +upstreamnt  +downstreamnt
atgtttaggatcggcaggcgacagctctggaagcagagtgtcacccgtgttctgacgcaa
cgactgaaagaagagaaggaagccaagagggctcgtctggatgggcggcatgactatctg
tttgcaattgtagcttcctgtttggacctgaacaaaccggaagtggaagatgcccttctt
gagggtaatcagattgaaagaatcgaccagctttttgctgttggaggacttcgtcatctc
atgttttactatcaggatgtggagggagcagaagcagggcagttcggctcctcaggaggg
gtgaaccctgcttctggaaagatgaaaaagcccaaggtgttcgtgaccgaaggaaaggat
gttgctcttatgggagcatgcgtgttcttcaccagggctgacccatccaaagccatcacg
gctgagaacatccaccgggaggtgagctttaacacgttagacactgcagatgggggcctg
ttgaacagcgtgaggcgtctgctctcagacatcttcatcccagctctcagggcctcaagc
catggctggggtgagctggagggactacaggatgcatccagcattcagcaggagttcctg
agctctctggaaggctttgtgggcatcttgtcaggtgcgcagaacagtctgaaggagaag
gtgaaccttcaaaaatgtgacatagttgaactaaaatctctgaaggaacccatggactac
ttggctcttgctagtaacccggagactgtggaaaaagtagagtgttgcatgagagtgtgg
atcaaacagatggaacagatcctcgctgagaacaatcagctgcggaaggaagcagatgat
gttgggccccgagcagagttggagcactggaaaaaaaggctctccaaatttaattacctt
ttagatcaattgaaaagccccgatgtgaaggccgtgctggcgatgcttgccgcggcaaag
tccaagcttctgaaggtttggcgggatgcagacattagagtcactgatgcagccaatgaa
gcaaaggacaatgtcaaatatttgtacacactggagaaatgctgtgaccctctgtacagc
agtgaccctgtaactatggtagatgctattcctacacttataaatgcaattaagatgatc
tacagcatttctcactactataacacctccgagaggattacgtctttgtttgtaaaggtg
acaaatcagatgatatctgcatgtaaagcccatatcaccaacaatgggactgccaccatc
tggagccagcctcaggacattgttatgcaaaaaatagcagctgcgattaaacttaagcag
gggtaccagtgctgctttcaggagacaaaacaaaagcttaagcaaaatccaagtgaaaaa
caatttgactttagtgagatgtatatatttggaaaatttgaaactttccaccaacgtctg
gccaagataatggacatcttcactaccttcaagacatactcagtcctgcaagattccaaa
atagaggggttggaagacatggtgactaagtaccaggacgttgttgctggcataaagaag
aaggagtataacttcttagatcaacggaaaatggattttgaccaagattatgatgagttt
tgcaagcagacgaatgagctccacagtgaactgcaaaggttcatggacaccacattcgaa
aagattcaaagcacaaggcaagctctgagcacgctgaagaaattcgaaagattgaatata
cctaaccttggtattgaggcgaaataccaaatagtttttcagaattttgggactgacatc
gacatgatttctaagctgtatacgaaacagaagtacgatcctcccttggctcgcgatcag
cctcccatagctgggaagatcttgtgggcccggcagctattccacaggctggagcagcca
atgcaactcttccagcagcacccttttgtgctgaggactgtggaggccaaacctgtgatc
cgcagttataacaggatagccaaggtcctcttggagtttgaggtcctctaccatagagcc
tggcttcagcagattgaagaaattcacgtgggtcttgaggcttctttattggtgaaggct
ccaggcacagggcagttgtttgtgaactttgatcctcagatattaatcttatttagagaa
acacagtgcatgtcccagatgggtctacctgtgtcaccatttgcagctgccctcttcgag
aagcgggacatgtacaaaaagaacttcagtgacatgaagatgatgctgtctgaataccag
agagtgaagttgaaaatgcctcctgccattgagcagttgatgctcccgcacttggcgaga
gtggatgaagccctccagcctggcctggctgtcctgacttggacgtccctgaatattgga
acctatttagaaaatgcttttgaaaagatcaaggacctggagctgctgcttgaccggatc
aatgacttgattgagttccgcatccatgccatcttggaggaaatgagcagcgtggccctt
tgtcagctccctcaggatgaccccctgacttgtgaagaattcctccaaatgacaaaggac
ctttgtgtgaatggcgctcagaaactccattttaaaagctccctagtggaggaagcagta
aatgagctaataaacatgttattggatgtggacgtcctacctgaagaagcatctgaaaaa
gtccgccatgagaatgccagtcccaacggggacacttcaggaggaggagaggggtgtgcc
gaggccttggcatcttcctttaatgctgggactagttctctgccgttaaccacaattgca
agaaagaagaaagaaatggaggtgttagaggaagcccgtgagctgctctcctattttaac
caccaaaacacggatgctcttttgaaagtgaccaggaatacacttgaggccattcgtagg
cgcattcatttctcccacatgattaacttccgggacagtaaaggtgcatctaaggtgaag
cagaaccatcttcccattttccgggcaagtgtcaccctggccattcccaacatttctatg
actcctgccctggaagacatacagcagacactgaacaaagctgtggaatgtatcatcagt
gtccccaagggggttagacagtggagcagcgagctgttgtcaaagagaaagatgcgtgaa
agaaagatggctgctgtgcagagcaatgaagacagtgattctgacactgaggtggaggaa
agtgaactccaagaaacactggagttagcatctgtaaacttgcccattcccgtgcaaacc
cagaattattataagaatatttctgacaacaaagagattgtgaaattagtctctgtgctc
agcacggtcatcagctccaccaagaaggaagttatcacatccatggaccgcttcaaatgc
tacaatcacatttggcagaaggagaaagaagataccattatgacctttattgcacaaaac
cctttgctttctgagtttgagtccaggattctttatttccaaagcctggagcaggaaatt
aatgcagagcctgaatacatctgtgtgggttccattgctctatacacagctgatttgaag
ttttctctgactgcagagacgaaggcctggatgatggttctaggccgtcactgcaacaga
aagtacaggagtgagatggaaaacattttcacagttgttgaagaattccagaagaaactg
aatcggccaattaaagacttggatgatattcggattgcaatggcagccctgaaagaaatc
agggagcagcagatctccactgacttccaagtgggaccaatcgaggaatcctatgccctc
cttaacaagtatgggcttctggtagccaaggaagagatggacaaagtggacactctgcgc
tatgcttgggagaagctgctggcccgcgccagtgatgtgcagaatgagttaggggctctg
cagcccagtttccggaaagagctgatcagcacagtggaggtgttcctccaagactgccag
cagttttacctggactatgatttgaatggtccaatggtaagtggactgaagccccaggaa
gccagcgacaggcttattatattccagaatcaatttgataacatatatcgtaaatatatc
acctacaccggaggagaggaactttttggtttgccagttacacagtatcctcagcttctc
gagataaagaagcagctaaatcttctgcagaaaatatacagcctgtacaacaatgtcata
gagactgtgaacagctatcaagataccctttggtccgaagtgaatattgaaaaaatcaac
agtgaactcttagaattccaaaataggtgtcggaagctgccccgggccctgaaggattgg
caggcctttctggacatgaagaagaccattgatgactttagcgagtgttgcccactgctg
gagtacatggctagtaacgccatggtagagaggcactggcagaggataaccactctcact
gggcacagtctggatgtgggcaatgaaacctttaagttacgaaatatcatggaggttcct
cttttgaaatacaaagaggaaattgaggacatttgcatcagtgcagtgaaggagagagac
attgagcaaaagctgaagcaagtgatcaatgagtgggacaacaaaacgttaacattcagc
agctttaagacccgtggagaactcctcctgagaggagacagtacctcagaagtcattgcc
agcatggaggacagcttgatgctattgggctctctcctgagcaataggtacaacatgcca
ttcaaagcccagattcaaaactgggttcaatgcctttccaactcaacagacatcattgag
aactggatgaccgttcaaaacttgtggatttatctagaagctgtcttcgtgggaggagac
attgccaagcagcttcccaaggaagccaagcgcttttccaatatagataagtcttgggtg
aagatcatgacgcgggcacatgagataccaaatgtggttcagtgttgtgttggcgatgag
accatggggcagctgttgccacacttactggaccagctggaaatctgccagaagtcactc
acaggatacttggagaagaaacggctgtgctttcctcgcttcttctttgtctcggatccc
gctctgctggagattctgggccaggcatctgactcccacaccatccaggcccatttgctg
aatgtgtttgacaacattaaaactgtcaagttccatgacaagatctatgatcggattctg
tcaatttcctctcgggagggcgagacaattgaattggacaagcccgtgatggcagagggc
aatgtggaggtctggcttaattctctgctggaggaatctcagtcctcattacatcttgtg
attcgccaggcagctgcaaatattcaagaatctggtttccagttgattgaatttctttct
tccttccctgctcaggttggattattaggaattcaaatgctatggacccgagactcagaa
gaagcccttcaaaatgccaagtttgataagaaaatcatgcagaagaccaaccagtccttc
ctagagttactgaacatgctgattgagatgaccacaaaggacctgagttccatggagcgg
gttaaatatgagactctgattactattcatgtgcaccaaagggacatctttgatgacctg
tgtcacatgcacgtcaagagccctacggactttgagtggctgaaacagtgcaggttttat
tttaaggaggattctgacaagacgatgatccacatcacagacgtggctttcacataccag
aatgagtttttaggctgcactgacagacttgtcataactccgctcacagacaggtgctac
atcacattggctcaagctctgggcatgagcatgggaggagcccctgctggtcctgcaggg
acaggcaagacagagaccaccaaggacatgggccggtgtcttgggaagtacgttgtagtt
ttcaactgctcagaccagatggatttccggggacttgggcggatattcaaagggctggca
cagtctgggtcctggggttgttttgatgaattcaaccgtatcgatctaccagtcctgtcg
gttgcagcccagcaaatctccattattctcacgtgtaaaaaggagcataagaaatctttt
atttttactgatggagataatgtgaccatgaacccagaattcggactttttctaaccatg
aaccctggctatgctggacgccaggagctccctgagaacttgaagatcaacttccgctct
gtggctatgatggtccctgaccggcagattatcatcagggtgaagttggccagctgtggc
ttcattgacaatgtagttctggcccgaaagttcttcacgctctaccagctgtgtgaggag
cagctctcaaagcaggtacactatgacttcggtctaagaaacattctgtcagttctgcgc
acactgggagcagcaaaaagagccagtcacacggatacagaatccaccatcgtaatgcgc
gtgctacgtgacatgaatctttccaaactgattgatgaagatgaacccctgtttttgagt
ttgattgaagatctatttccaaatattcttttggacaaagcaggctaccctgaactggag
acagccatcagtaaacaggttgaggaagctggcttaattaaccatcctccttggaagctg
aaagtcatccagctatttgaaacacagagggtaaggcatggaatgatgaccctggggcct
agtggatcagggaagaccagctgcatccacaccctgatgaaagctatgacagattgtgga
aaaccgcacagagaaatgaggatgaatcccaaagcaattactgctccacagatgtttggt
cgacttgatgtggccacaaatgattggaccgatggaatattttctaccctttggaggaag
acactgaaagcaaagaaaggggaacatatctggatcgttcttgatggtccagttgatgcc
atctggattgaaaatctgaattctgtgttggatgataataaaaccctgactctggccaat
ggcgaccggattcccatggctccaaactgcaagatagtttttgaacctcataacattgac
aatgcttctcccgccactgtctcaagaaacgggatggttttcatgagttcctctgtcctc
gactggagtcctattcttgagggttttctcaagagacggtctcctcaagaggctgaaatc
cttcgacagctgtacgcagagacttttccagacctgtatcggttcagcattcagaacctg
gagttcaagatggagatactggaggcctttgtgatcacacagagcacccacatgctgcaa
ggcctgattcccacaaaggagcaggccggggacgtggacccagagcacctggggaggctg
tttgtctttgccatgatgtggagtgtgggtgcagtcctggagttggaaggtcgccggagg
atggaactctggctgcgctcacgagaagggcccacactgcacctgccacagctgaccgat
cctggggacaccatgtttgattactatgttgcaccggacggtacttggaggcattggagt
atgtgtatcccagaatacgtgtatccacctgataccaccccagagtatggatctatcctt
gtgccaaatgtggacaatgtgcggaccgacttcctaattaaaaccattgccaaacaaggc
aaggctgtgctgttaattggtgagcaaggaacagccaaaacagtcatcatcaaaggattt
atgtcaaaatttgaccctgaaagtcacacggtcaagaatctgaacttttcttcggcgacg
accccactgatgtttcagaggacaatagagagttatgtggataaacgcatgggcacaaca
tatggtcctcctgcggggaagaaaatggctgtctttattgatgatttaaatatgccagta
atcaacgaatggggtgatcaggttactaatgagattgtccgacagctgatggaacagaat
ggattctataacctagagaagcctggagagttcactagcattgtggacatccagttcttg
gcagccatgatccatcctgggggtggacgcaatgacataccacagaggttgaagagacag
ttctccatattcaactgtaccttgccttctgatgcttccatggacaagatctttggtgtg
attggggaaggctactactgtgcccagcggggcttctcaaaggaagtgcaagatgctgtg
ataaagcttgtacccctgacacgccgcctgtggcagatgaccaaactgaagatgctccca
acgcctgcaaaattccactatgtgtttaaccttcgagacctttccaggatctggcagggc
atgctgaatatcacttcagaggtcatcaaagacacagatgaactgcttaggctgtggaag
catgagtgcaaacgtgtgatagctgatcgctttagcatgtccagtgatgtgacctggttt
gataaggctgttgtcagtttggtagaggaggagtttggtgaagagaaaacaccggtggtg
gattgtggagttgatgcttattttgtggatttcttgagggatgcaccagaagctacaggt
gaaacacctgaggagactgatgctgaaatgccaaagctttatgagccgattgcctccctt
aatcacctgcaagagcgtctgagcgtgttcctgcagctctataatgagagcatccgaggc
actggcatggacatggtgttcttcagagatgcgatggttcacttagtcaagatctctcga
gtcatccgcactcctcggggaaatgccctcctggttggtgtgggtggatcaggaaagcag
agtctgacaaggctggcttccttcattgcgggctatacctctttccagatcactctgaca
agatcctacaacacctcaaatctgatggaagacctgaaggttttgtacaggactgctggc
cagcaaggcaaagggatcactttcattttcacagacaatgagattaaagaggagtcgttt
ctggaatatatgaacaatgtcctgtcatcgggtgaggtctccaacctctttgctcgggat
gaaattgatgagatcaatagtgacctgacatccatcatgaagaaggagcaccccaagcgc
ccacccaccaatgacaacctgtatgagtatttcatgagcagggtccgaggaaacctgcac
attgtgctctgcttttcacccgtgggagagaaatttcgaaatcgagctttgaagttccct
gcccttatttcaggatgcacaattgactggttcagccgatggcccaaggatgctttagtt
gctgtgtcggaacatttcctctcatcctataacattgactgcaccgctgagatcaagaag
gaactggttcaatgtatgggctcctttcaggacggggtagctgagaagtgcgccgattac
ttccagaggttccggcgctctacccacgtgacgcccaaatcatacctctcctttattcag
ggctataaattcatctatgaagaaaaacacgtggaagtgcagagcctggccaacagaatg
aatactggattggaaaagctaaaagaagcttcagaatcagttgcagccctgagccaagaa
ttggcagtaaaggagaaggaactgcaggtggccaatgagaaagctgacatggtcttaaaa
gaagtcacaatgaaagcacaggctgctgagaaggtcaaggctgaggtacagaaggtgaag
gacaaagcacaggccattgtcgacagcatctccaaggacaaagccattgcagaagagaaa
ctagaggccgcaaagccagccctagaagaggcagaagctgcactccagaccattaagccc
tctgacatcgccacagtgcgcacactgggccgaccccctcacctcatcatgcggatcatg
gactgcgtgctgctgctgtttcacaggagggtcaatgcagtgaaaattgacctggacaaa
agctgcaccgtgccttcctggcaggaatctttgaaattgatgactgcaggaaactttctc
cagaatctacagcagttccccaaagacacaatcaatgaagaagtgatagaatttttgagt
ccttactttgaaatgtccgactacaacatcgagaccgccaagcgcgtctgtgggaatgta
gctggtctttgttcctggaccaaagctatggcttcctttttctctataaacaaggaggtg
ctccctctgaaggccaacttgatagtgcaagagaatcgtcatgccctggccatgcaggac
ctgcagaaagcccaggctgagctggatgacaagcaagcagagcttgatgtggtgcaggca
gagtacgaacaggccatgactgaaaagcagaccttgcttgaagatgctgatcggtgcagg
cataagatgcagacggcgtccacgctcatcagcggcttggcaggtgaaaaggagcgatgg
acggaacaaagtaaagagtttgctgcacaaattaaacgactcgtaggggatgtgctgctg
gcaacggcttttctatcatattctggtccatttaaccaagagtttcgagatctgctcctg
aatgattggaagaaggaaatgaaagctcgtaaaatcccatttggaaatgacctaaatctt
aatgagatgctgattgatgccccgactatcagtgaatggaacctacaaggccttccaaac
gatgacctatccatccagaacggaattattgtcacaaaagcctcacggtctcctttgcta
atcgatccccagacccaaggcaagatctggattaggaacaaagaaagccaaaatgaactc
cagatcacatctctaaaccacaagtactttagaaaccacctggaggacagcctttccctt
gggagacctttgctcattgaagacgttggggaggagttggatcctgctctggacaacgtt
ttggaaaaaaacttcattaaaacgggatctacttttaaggtgaaggtcggtgacaaggaa
gtggatgtcatggatggctttaaactttacatcactaccaagctgccgaatccagcctac
accccagaaatcagtgctcggaccgccatcattgacttcactgtcactgtgaaaggcctg
gaggaccagttactggggagagtcatcctcacagagaagcaggaactggagaaagaacga
actcatctcttggaagaggtaacggcaaacaaaagaaggacgaaggagctagaagataat
ttgctttatcgcctgacgagcactcaagggtccctggtggaagacgagagtctcattgtt
gtgctgagcaacaccaagaagacagccgaggaagtgacacagaagctggaaatttctgga
gagacagaaattcaaattaactcagcccgggaggagtaccgacctgttgctacacggggc
agcatcctctatttcctcatcacggagatgcgcttggttaatgaaatgtatcagacttcg
ctccgtcagtttctgggcctgtttgacctttccttagccaggtctgtcaagagcccaatt
acaagcaagagaattggtaacatcatcgagcacatgacctatgaggtttttaagtacgcc
gtccaaggcctctatgaggagcacaaattcctgttcactttgttgctcaccctaaagatt
gacatccagaggaacctagtcaagcacgaggagtttctcactctcattaaaggcggtgcc
tcattggatcttaaagcctgtcctcataaaccatcaaaatggatccttgacatgacttgg
ctgaatttggtggaacttagcaaacttaaacagttttcagacatcctcgatcagatatca
aggaacgaaaaattgtggagaatttggtttgacaaagaaaacccagaagaggagccactt
cctaatgcctacgataaatctcttgactgctttagacgcctccttcttattaggtcctgg
tgtcccgacagaaccattgcccaggctcgcaagtacatcatggactccatgggagaaaac
tatgcagagggagttatcctggacttggaaaagacatgggaggaatctgacccacggaca
ccactcatttgcctcctgtccatgggctccgaccccacagattccatcattgctttgggg
aagagactaaaaatagaaacacgctatgtgtccatgggccagggccaggaggtccatgca
aggaagctgttgcaccagaccatggcaaacggaggatgggtacttctacagaactgccac
ctgggacttgacttcctggacgaactaatggatgtagtcacagaaacggagactgtgcat
gatactttccgcctgtggattaccaccgaggttcacaagcagttccccatcactctcctt
cagatgtccatcaagtttgccaatgagccacctcagggcctccgggcaggcctgagaagg
acctatggtggcgtgagccaggacctactggatgttagtgtgggggcccagtggaagccc
atgctgtatgcagtggccttcctacactctactgtccaggaaagacgcaagttcggtccc
ctagggtggaatatcccctatgaatttaaccaagcagacttcaatgccacggtacagttc
attcaaaaccacctggatgatatggatatcaagaagggtgtatcctggaccactgtccgg
tacatgataggagaaattcagtatggaggcagagtcactgatgactatgataagaggttg
ctgaacacatttgcaaaggtttggttcagtgaaaacatgtttggaccagattttaccttt
taccaaggatacaacattccaaaatgcagtacagtggatggctatctccagtatatccag
agcttgcctgcctatgacagcccagaggtttttgggctccaccccaatgctgacattact
taccagagcaagctggccaaagatgtactggacactatcctgggcatccagcccaaggac
agctctggcggaggggatgagacaagggaggctgtggtggcccgtctggctgatgatatg
ctggagaagcttccagaagattatagtccttttgaagtgaaggagagactgcagaagatg
ggaccattccagcccatgaacatcttcctcaggcaggagattgacaggatgcaaagggtc
ctcagccttgtccgtagcaccctgactgagctgaaactagctgttgatggcaccattatc
atgagcgacaatctgcgagatgctctggattgcatgtttgatgccagaatcccggctcgg
tggaaaaaggcatcatgggtttctagtaccctgggcttctggtttactgaacttctagaa
agaaactgccagttcacatcctgggtttccaacggtagaccccactgcttttggatgaca
ggtttctttaacccccagggattcttaactgcaatgcgacaggaaataactcgagccaac
aaaggatgggctttggacaatatggttctttgcaatgaagtcaccaaatttatgaaggac
gacatttctgctcctcctacagaaggggtctatgtctatggcttatatcttgagggtgct
ggctgggacaaaaggaacatgaaactcattgaatccaaacccaaagtgctttttgagttg
atgcctgtcataaggatttttgcagaaaacaatactgcaagagatcctcggttgtactgc
tgtcccatctacaagaagccagttcgaacagacttgaactacatcgctgctgtggacctc
aagacagcccaggcccctgaacactggattctccgtggggttgcccttctctgtgatgtc
aagtaa

KEGG   Rattus norvegicus (rat): 298524
Entry
298524            CDS       T01003                                 

Gene name
Dnali1
Definition
(RefSeq) axonemal dynein light intermediate polypeptide 1
  KO
K10410  dynein light intermediate chain, axonemal
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    298524 (Dnali1)
   05016 Huntington disease
    298524 (Dnali1)
   05022 Pathways of neurodegeneration - multiple diseases
    298524 (Dnali1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    298524 (Dnali1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     298524 (Dnali1)
SSDB
Motif
Pfam: Ax_dynein_light RIB43A TSNAXIP1_N
Other DBs
NCBI-GeneID: 298524
NCBI-ProteinID: NP_001026817
RGD: 1309260
Ensembl: ENSRNOG00000024957
UniProt: Q4FZV3
Position
5
AA seq 258 aa
MIPPADSLLKYDTPVLVSRNTEKRSPKARPLKVTVQQPGPSGAGPQPPKAKLPSTSCVPD
PTKQAEEILNAILPPREWVEDTQLWIQQVSSTPSTRMDVVHLQEQLDLKLQQRQARETGI
CPVRRELYSQCFDELIREVTINCAERGLLLLRVRDEIRMTIAAYQTLYESSVAFGMRKAL
QAEQGKSDMERKITELETEKRDLERQVNEQKAKCEATEKRESERRQVEEKKHNEEIQFLK
RTNQQLKAQLEGIIAPKK
NT seq 777 nt   +upstreamnt  +downstreamnt
atgataccccccgcagactctctgctcaaatatgacaccccggtgttggtgagccggaat
acagaaaaacggagccccaaggctcggccactgaaagtcacagttcagcagcctggaccc
tctggtgcaggcccacaaccacccaaggccaagctgccctcaacttcctgtgtcccagat
cctaccaaacaagcagaagaaatcttgaatgccatcctgcctccaagggagtgggtagaa
gacacacagctatggatccagcaggtgtccagcacacccagcaccagaatggatgtggtg
catctccaggagcagctggacctgaagctgcagcagaggcaggccagggagacgggcatc
tgccctgtgcgcagggaactctactcccagtgttttgatgagctgatccgggaggtcacc
atcaactgtgcagagagaggactgctgttgctgcgtgtccgggatgagatccgcatgacc
atcgctgcctaccagactctgtatgaaagcagtgtagcattcggcatgaggaaggcactg
caggccgaacaggggaagtcagacatggagaggaaaattacagaactggagacagaaaag
agagacttggagaggcaagtgaatgaacagaaggcgaaatgtgaggccaccgagaagcgg
gagagcgagaggcgacaggtggaggagaagaagcacaatgaggagatccagttcctgaaa
cggactaatcagcaactgaaggcccaactggaaggcattatcgcaccgaagaagtga

KEGG   Rattus norvegicus (rat): 300078
Entry
300078            CDS       T01003                                 

Gene name
Dnal4
Definition
(RefSeq) dynein light chain 4, axonemal
  KO
K10412  dynein light chain 4, axonemal
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    300078 (Dnal4)
   05016 Huntington disease
    300078 (Dnal4)
   05022 Pathways of neurodegeneration - multiple diseases
    300078 (Dnal4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    300078 (Dnal4)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     300078 (Dnal4)
SSDB
Motif
Pfam: Dynein_light DUF3109 Ground-like
Other DBs
NCBI-GeneID: 300078
NCBI-ProteinID: NP_001009666
RGD: 1309099
Ensembl: ENSRNOG00000015583
UniProt: Q5PPH7
Position
7
AA seq 105 aa
MGEAEGKKEEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKYSNNNESAAKMIKET
MDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggagaggctgaagggaagaaagaggaggctgactataagcgcctgcagaccttcccc
ctggtcaggcactcggacatgccagaggagatgcgagtggagaccatggagctttgtgtc
acagcctgtgagaaatactccaacaacaatgagagtgctgcaaagatgatcaaggagaca
atggacaagaagttcggctcctcctggcacgtggtgatcggcgagggttttgggtttgag
atcacccacgaggtgaagaacctcctgtacctgtacttcgggggaaccctggccgtgtgt
gtgtggaagtgctcctga

KEGG   Rattus norvegicus (rat): 303242
Entry
303242            CDS       T01003                                 

Gene name
Dnah2
Definition
(RefSeq) dynein heavy chain 2, axonemal isoform X1
  KO
K10408  dynein heavy chain, axonemal
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    303242 (Dnah2)
   05016 Huntington disease
    303242 (Dnah2)
   05022 Pathways of neurodegeneration - multiple diseases
    303242 (Dnah2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    303242 (Dnah2)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     303242 (Dnah2)
SSDB
Motif
Pfam: AAA_6 DHC_N1 DHC_N2 AAA_8 Dynein_C AAA_9 AAA_7 MT AAA_lid_11 Dynein_heavy AAA_5 Dynein_AAA_lid AAA_lid_1 AAA AAA_16 AAA_22 TsaE NB-ARC Mg_chelatase Sigma54_activat Sigma54_activ_2 AAA_33 DUF815 DUF3452 ATP_bind_1 Bac_DnaA CbiA cobW Guanylate_kin
Other DBs
NCBI-GeneID: 303242
NCBI-ProteinID: XP_008766120
RGD: 1565087
Ensembl: ENSRNOG00000052688
UniProt: A0A0G2JYL5
Position
10
AA seq 4508 aa
MASKAEKKRKVGGRGGPRAGRPGRPPQSTVAPGVEKETSQLPIIPEPEYEPMKEESEQDL
EEPEEPKEPDLSTDVKPIFLSRAMLTGLADSTWTAEHDAVLEHFAQDPSVPVLTIFVDPV
FGLKLELGMPVQTQNQIVYFIRQAPVPITPENFEETVQYGTVRGAYIPALLRLLSGVYVP
QIFMNKSWPESIRNHFVSHLHRFLASLTDTRYKLEGHTVLYIPAEAITMDPAVVIKDKEL
VQRLETSMIHWTRQIKEVLSAQESVDTGENLGPLEEIEFWNNRCMDLSGISKQLVKQGVK
HIESILLLAKSSYLAPFRKLAQQIQDGSRQAQSNLTFLSILREPYQELAFMKPKDISDKL
PKLISLIRIIWVNSPHYNTRERLTGLFRKMSNEIIRLCCHSVSLDRIFEGYVSSSKEDLQ
GCISCCHAWKEHYLRAVQMHTQFSNRGWVLDQTSIFAQVDAFVQRCKDLIEVCDCQYHFA
RWLDGTQGPLPCFFGAQGPQITRNLLEIEDIFHKNLQTLRAVRGGILDVKNTSWHEDYNK
FRAGIKDLEVMTQNLITSAFELVRDVEHGVLLLDTFHRLANREAIMRTYEKKAVDLYMLF
NSELALVNRELNKKWPYLEPYMAQYSGQAHWVRILRRRIDRVMNCLSGAHFLPHIGTGEE
TVHTYQQMVQAIDELVRKTFQEWTATLDKDCIRRLDMPLLRISQEKAGMLDVNFDKTLLI
LFVEIDYWERLLFETPHYVMNVADRAEDLRILRENLLLVARDYNRIIAMLSPDEQALFKE
RIRFLDKKIHPGLKKLNWALKGASAFFITECRIHASKVQMIVNDFKASTLTIGWKAQEMS
ELLLVHITGKQVYRDLEFEEAQREHRMAVQQKLVNLHQDVINILTNSFEVFKNDGPEIQQ
QWLLYTIRLDHMMEDALRLNVKWSLLELSKAINGDGKTSPNPLFRVLVILQSDVQGGGAQ
VEFSPTLQTLASVVNDIGSHLFSTISVFRHLPDILTKRKMTREPIHVVVERDEDIRKIQA
QISSGMTNNASLLQNYLKTWDMYREIWEINKDSFIRRYQRLNPPVSSFDADIARYTEVAN
NVQKEETVLNIQFVMLDCSHLKFSLVQHCNEWQNKFTTLLKEMAAGRLMDLHTYLKDNAE
KISRPPQTLEELGVSLQLMDTLQHDLPNLETQIPPIHEQFTILEKYEVPVPDTVLEMLES
LNGEWLTFQQILLDSEQMLKKHKEKFKTGLIHAADDFKKKAHNLLEDFELKGPFTSNVGH
TAALDQIAQVRAMLMAMREEESNLRSNLGIFKIEQPISKDLQNLEKELDALQQVWEITRD
WEESWNQWKTGCFLTLQTEAMESMAHGLFRRLTRLAKEYKDRNWEVIETTRAKIEQFKRT
MPLISDLRNPALRERHWDQVKEEIQREFDQESESFTLEQIVKLGMDQHVEKIAEISASAT
KELAIEVGLQNIAKTWDSTQLDIVPYKDKGHHRLRGTEEVFQALEDNQVALSTMKASRFV
KAFEKDVDHWERCLSLILEVIEMVLTVQRQWMYLENIFLGEDIRKQLPNESALFDQVNNN
WKGIMDRMNKDNNALRSTHYPGLLETLIEMNTILEDIQKSLDMYLETKRHMFPRFYFLSN
DDLLEILGQSRNPEAVQPHLKKCFDNIKLLKIQKVGGSSSKWEAVGMFSGDGEYIDFLHP
VLLEGAVESWLGDVERAMRMTLRDLLRNCRMALKKFLNKRDKWVKDWAGQMVITASQIQW
TADVTKCLMTAKERSDKKILKVMKKKQVSILNKYSEAIRGNLTKIMRLKIVALVTIEIHA
RDVLEKLYKGGLMDVNAFDWLSQLRFYWEKDVDDCIIRQTNTQFQYGYEYLGNSGRLVIT
PLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGTYVIVVNCSEGLDYKSMG
RMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALTANLTRFYFEGFEINLVWSC
GIFITMNPGYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTL
YSLAVQQLSRQDHYDFGLRALTSLLRYAGKKRRLQPDLTDEEVLLLSMRDMNIAKLTSVD
VPLFNAIVQDLFPNIELPVIDYGKLRDTIEQEIREMGLQITPFTLTKVLQLYETKNSRHS
TMIVGGTGSSKTTSWRILQASLTSLCRAGEPNFNIVKEFPLNPKALSLGELYGEYDLNTN
EWTDGILSSVMRAACADEKPDEKWILFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMP
EQVSLLFEVENLAVASPATVSRCGMVYTDYVDLGWTPYVQSWLEKRPKAEIEPLQRMFEK
FINKILTFKKDNCNELVPVTEYSGIISLCKLYTVLATPENGVNPADTENHAFMVEMTFVF
SMIWSVCASVDEDGRKKIDSYLREIEGSFPNKDTVYEYYVNPKMRTWSSFEEQLPKSWRY
PPNAPFYKIMVPTVDTVRYNYLVSTLVANQNPVLLVGPVGTGKTSIAQSVLQSLPSSQWS
VLVVNMSAQTTSNNVQSIIESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPL
ELIRLWIDYGFWYDRVKQTIKHIRDMFLMAAMGPPGGGRTVISPRLQSRFNIINMTFPTE
SQIIRIFGTMINQKLQDFEEEVKPIGNVVTEATLDVYNTVVQRFLPTPAKIHYLFNLRDI
SKVFQGMLRANKDFHDTKASITRLWIHECFRVFSDRLVDTTDMEAFIGILSDKLGTFFDL
TFHHLCPNKRPPIFGDFLKEPKVYEDLVDLSVLKTAMETALNEYNLSPSVVQMQLVLFRE
AIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICEYNTFQIEVTKHYRKQEFRD
DIKRLYRQAGVELQATSFLFVDTQIADESFLEDINNILSSGEVPNLYKADEFEEIQNQII
DQARAEQISESSDSLFAYLIERVRNNLHIVLCLSPVGDPFRNWIRQYPALVNCTTINWFS
EWPREALLEVAEKYLVGVDLGTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRHNYVTP
TNYLELVSGYKKLLGEKRQELLDQANKLRTGLFKIDETREKVEVMSLELEDAKKKVAEFQ
KQCEEYLVIIVQQKREADEQQKAVTANSEKIAIEEVKCQALADNAQKDLEEALPALEEAM
RALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRGNEPTWAEAKRQLGEQNFIKSLIYF
DKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIR
MNAAIAQLQEKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERA
GMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLIAAAFLSYMGPFLTNYRDEIVNQIWIK
KIWELQVPCSPRFAIDNFLTNPTKVRDWNIQGLPSDSFSTENGIIVTRGNRWALMIDPQA
QALKWIKNMEGNQGLKIIDLQMHDYLRVLEHAIQFGFPVLLQNVQEYLDPSLNPVLNKSV
ARIGGRMLMRIADKEVEYNPNFRFYLTTKLSNPHYSPETSAKTTIVNFAVKEQGLEAQLL
GIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLQTS
KITATEVTEQLETSETTEINIDLAREAYRPCAQRASVLFFVLNDMGRIDPMYQFSLDAYI
SLFILSIDKSHRSNKLEDRIEYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKILETSG
KLNMDEYNFFLRGGVVLDREGQMDNPCTSWLADAYWDNITELDKLTNFHGLMNSFEQYPR
DWHLWYTNSNPEKAMLPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIVSNLGSRFIEP
PVLNMKLVMEDSTPRSPLVFILSPGVDPTSALLQLAEHTGMAHRFHALSLGQGQAPIAAR
LLREGVNQGHWVFLANCHLSLSWMPNLDKLVEQLQVEDPHPSFRLWLSSSPHPDFPISIL
QASIKMTTEPPKGLKANMTRLYQLMTEAQFTHCSKPTKYKKLLFALCFFHSILLERKKFL
QLGWNIIYGFNDSDFEVSENLLSLYLDEYEETPWDALKYLIAGVNYGGHVTDDWDRRLLT
TYINDYFCDLSLTTPSYRLSVLDTYYIPKDGSLASYKEYISLLPSMDPPEAFGQHPNADV
ASQITEARTLFETLLSLQPQITPTRIGGQSREEKVLELAADVKQKIPEMIDYEGTRKLLA
LDPSPLNVVLLQEIQRYNKLMKTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPL
WGKVYPSQKPLASWTRDLAVRVEQFETWANRAHPPVLFWLSGFTFPTGFLTAVLQSAARQ
NNISVDSLSWEFIVSTVDDSNLVYPPKDGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCL
MPTIHFRPAESRKKSAKGMYSCPCYYYPNRAGSADRASFVIGIDLRSGAMTSDHWIKRGT
ALLMSLDN
NT seq 13527 nt   +upstreamnt  +downstreamnt
atggcaagcaaagcggagaagaagcgaaaagtgggtggccggggaggcccccgggcaggc
cgacctggccgacctcctcagtccactgtggccccaggagttgagaaggagacttctcag
ctgcctatcattccggagccagagtacgagcccatgaaggaggagtctgagcaagatctg
gaggaacctgaagaacctaaagaaccggacctttcgacggacgtgaagcccatcttcctc
tcacgagctatgttgactggactggcagattcgacatggacggcggagcatgatgcggtt
ctggaacactttgcccaggatccctcggtgcctgtcctcaccatctttgttgaccctgtc
tttgggttgaagctggagctgggtatgcctgtgcagacccagaatcagattgtgtacttc
attcgacaagcaccagttcccatcaccccagagaactttgaggaaaccgtgcagtatggg
acagtgcggggtgcctacatcccagcgttgctacggctgctcagcggtgtctacgtccct
cagatttttatgaataagtcttggcctgagagcatccgaaatcattttgtttcacacctt
cataggtttttggcctctctgacagacactcggtacaaactggagggtcacacggtcctg
tacatccctgcagaggccataacgatggaccccgcggtggtgataaaggacaaagagctg
gtacagcggctggagacctccatgatccactggacgcggcagatcaaggaagtgctgagt
gctcaggagtctgtggatacaggagaaaacttaggtcctttggaagagatcgagttctgg
aacaaccgctgcatggacctgtccggcatcagcaagcagctggtgaagcagggcgtgaaa
cacatcgagtccatcctgctccttgccaagtcgtcctacctagcgcccttcaggaaactg
gcccagcagatccaggatggctctcggcaagctcagtccaacctgactttcttgtcaatt
ctgagggaaccctaccaggagctggccttcatgaaacctaaggacatctccgacaaactc
cctaagctgatcagcctcatccgaatcatctgggtcaactctccccactacaacactcgg
gaaaggttgactggcctgttccggaagatgagcaacgagattatccgtctatgctgtcac
tccgtctctttggaccgaatctttgagggctatgtctcttccagcaaggaagacctgcaa
ggctgcatttcctgttgccacgcctggaaagagcactacctgcgcgccgtacagatgcat
acccagttctccaaccggggctgggttctagaccagacgagcatatttgctcaagtagac
gcctttgtgcagcgctgcaaagatcttattgaggtatgcgactgccagtaccactttgcc
cgttggttagacggcacacagggtccccttccatgcttcttcggtgcccaggggccacag
atcacacggaacttgctagaaattgaggacatctttcataaaaatctgcaaacgctgcga
gctgtgcgtgggggcatcctagatgttaagaacacctcttggcacgaggactacaataaa
ttccgtgctggtatcaaagacctggaggtgatgacccagaatctgatcacatcagccttt
gagttggtccgggatgtggagcacggagtgctgctcttggacactttccacaggctggcc
aatcgggaggccatcatgcgaacctatgagaagaaggctgttgacctctacatgctgttc
aatagcgagttagccctggtgaaccgggagttgaacaagaagtggccatacctggagccg
tacatggctcagtattccggacaggcccactgggtgcggatcctccggcgtcgcatcgac
agagtcatgaactgcctctctggagctcacttcctgccccacattgggactggagaggag
actgtacacacctatcagcagatggttcaagccattgatgaattggttcgaaaaaccttc
caagagtggacagcaacgctggacaaggactgcatccgacggctggacatgccactatta
cgaattagccaggagaaggcaggcatgctggatgtcaactttgacaagacgctcctgatc
ctctttgtggagattgactactgggagcggctgctgttcgagacaccccactacgtgatg
aacgtggctgatcgcgctgaggacctgcgcattctccgggagaacctgctccttgttgct
cgagactacaacaggatcattgccatgctgtccccagatgagcaggccctgttcaaagag
cgcatccgattcctggataagaagatccacccaggactgaagaagctgaactgggcccta
aagggggccagtgccttcttcatcaccgagtgtcgcatacatgccagcaaggtgcagatg
attgtgaacgacttcaaggcctccaccctgaccatcggctggaaggcccaggagatgtcg
gaactgctgctggtgcacatcaccggcaagcaggtgtacagagacctggagtttgaggag
gcccagagagagcaccggatggctgtacaacagaagttggtgaacctgcatcaggatgtg
atcaacatcctgaccaactccttcgaagtattcaagaacgatggccccgagattcagcag
cagtggttgctctacaccatacggctggatcacatgatggaggacgccctgcgtctgaac
gtgaagtggtcactgctggaactctccaaggccatcaacggggacgggaagacctctcca
aacccactcttcagggtccttgtcattttacagagcgatgtgcagggtggtggggcacag
gtggaattctccccaacactgcagactctggcgagtgtggtcaatgacataggcagtcac
ctcttctctaccatctctgtgttccgtcacctccccgatatcctcaccaaacgcaagatg
actcgagaacctattcatgtggtcgtggagcgagacgaggacatcaggaagatccaggcc
cagatcagcagtgggatgacgaacaacgcaagtctgctgcagaattacctcaagacctgg
gacatgtatcgggagatctgggagatcaacaaggactccttcatccgaagataccagcgc
ctcaacccccctgtctcctctttcgatgctgacattgcccgctacacggaggtggcaaac
aacgtgcagaaggaggagacagtcctcaacattcagtttgtgatgctggactgctcgcac
ctcaagttctcactggtgcagcactgcaatgagtggcagaataagttcacaaccctgctc
aaagagatggctgccgggcgcctcatggacctgcacacctacctcaaagacaatgctgaa
aaaatcagccgccctccccagacgctggaggagctaggggtcagtttgcagctcatggac
accctgcagcatgacttacccaacctggaaactcagatcccccccattcacgagcagttt
accattttggaaaaatacgaggtgccggttcctgacacggtcctggagatgcttgagagt
ctcaatggggagtggctcaccttccaacaaatactgctggacagtgagcagatgctgaag
aaacacaaggagaagttcaagacaggcctcatccatgctgctgatgacttcaagaagaag
gcccacaaccttctagaagacttcgagctcaaagggccttttaccagcaacgtgggccac
acggctgcgctggatcagatcgcgcaggtgcgcgccatgctgatggccatgcgggaagag
gagagcaacctccgctccaacctgggcatcttcaagattgagcagccgatctccaaggac
ctccagaacctggagaaggagcttgatgccctccagcaagtgtgggagatcactcgggac
tgggaagagagctggaaccagtggaagacgggttgcttcctgaccctgcagacggaagcc
atggagtccatggcccacgggctgtttcgccgcctcacgagactagccaaagagtataag
gaccgaaattgggaagtcattgaaacgactcgcgccaaaatagagcagttcaagaggacc
atgccgctcatctctgatctgcggaacccagccctcagagaacggcactgggaccaggtc
aaagaggaaatccagagggagtttgatcaggagtcagaaagcttcaccttggagcagatt
gtgaaactagggatggatcagcatgtggagaaaatcgcggagatctcagcctctgcaacc
aaggagctggccatagaagtgggattacaaaacattgccaaaacctgggattcgactcag
ctagacatagtaccctacaaggacaagggccatcaccggctcaggggaacagaagaagta
ttccaggcactggaagataatcaggtggctctgtcgactatgaaggcatcccgattcgtg
aaggcctttgagaaggatgtggaccactgggagcgctgcctctctctcattctggaagtt
attgagatggtcctcaccgtgcagaggcagtggatgtatctagagaatatcttccttgga
gaggacatccgcaagcagctgcccaatgagtcagccctatttgaccaggtcaacaacaac
tggaaaggcatcatggaccgcatgaacaaagacaataacgctctgcggagcacccactac
ccaggcctcctggagacactgatagaaatgaacacaatcctggaggacatccagaagtct
ctggacatgtacttagagaccaagcgccatatgtttccccgcttctacttcttgtccaat
gatgacctgctggagattctgggccagtcccgtaacccagaggctgtgcagccacacctc
aaaaagtgctttgacaacatcaaacttctgaaaatccaaaaggtcgggggctccagcagc
aaatgggaagcagtaggaatgttctcaggtgacggtgaatacattgatttcctccaccca
gtacttctagaaggagctgtggagtcgtggcttggtgatgtggagcgggccatgaggatg
acgcttcgggatttgcttcgaaactgccgcatggccctcaagaagttcctcaacaagagg
gacaagtgggtgaaagactgggctggccagatggtgatcacggcgagtcagatccagtgg
acagctgatgtcaccaagtgcctgatgacagccaaagagcggtcagacaagaaaatcctc
aaggtcatgaagaagaagcaggtgtcaatactaaataagtattcagaggccatcaggggg
aacttgaccaagatcatgagacttaaaatcgtggctctggtgacaatagaaattcatgcc
cgtgatgtgctggaaaagctctataagggtggccttatggatgtcaatgcttttgactgg
ctcagccagctgcgcttctactgggagaaggatgtggatgactgtataatccgccagacc
aacacacaattccagtatggctatgagtacttggggaactctggtcggctggtcatcact
cccctgaccgacagatgttacatgacattaaccacagcactgcaccttcatcgtgggggc
tcccccaaaggcccagcaggtactggaaagacagaaactgtcaaggacctgggcaaggcg
ctgggtacatatgtcatcgtggtcaactgctctgagggcttggactacaagtccatggga
agaatgtactctggactggcgcagactggagcctggggctgctttgatgagtttaaccgc
atcaacattgaggtgttgtccgtggtggcccagcagatcctgtccatcctgtctgccttg
accgccaacctcacgcgtttctattttgagggctttgaaataaatctggtgtggtcttgt
gggatcttcatcaccatgaatcctggctatgctggtcgcacagagcttccagagaaccta
aagtccatgttccgcccaatcgccatggtagtgcccgattctacgcttattgcggaaatc
atcctctttggggagggctttggcaactgcaagatcctggccaagaaggtgtatactctg
tactcactggctgtgcagcagctctccagacaggaccattacgactttggcctgcgcgcc
ctcacttcccttctgcgatatgccggcaagaagcgccgcctccagccagatctgactgat
gaagaggttctgctgctctccatgagagatatgaacattgccaagctgacgtcagtggat
gttccattgttcaacgctattgtgcaggaccttttccccaacattgagctcccagtcatt
gactacggcaagctacgggacaccatcgagcaggagatccgagagatgggcctgcagatc
acaccttttaccctcaccaaggttctccagttgtatgaaaccaagaactctcgccactcc
accatgattgtgggtggcaccggcagcagcaagaccacctcctggagaattctacaggcc
tcactgacctccctgtgccgtgctggagaacccaacttcaacattgttaaagagttccct
ttgaacccaaaggcattgtccttaggggaactgtatggagagtatgacctcaacaccaat
gagtggactgatggcatcttgtctagtgtcatgcgggctgcatgtgcagatgagaagcca
gatgagaaatggatcctttttgacggccctgtggacactctgtggatcgagagcatgaac
tcggtcatggatgacaacaaggtgctgaccctcatcaatggagagcgcatcgcaatgcct
gagcaggtgtctctcttgtttgaagtggagaacttggctgtggcctctccagccactgtg
tcccgctgtgggatggtctacactgactatgtggacctgggctggacgccttatgttcag
tcatggctggaaaagaggccaaaggcagaaatagagccgcttcaacgcatgttcgagaag
ttcatcaacaagatacttaccttcaagaaggataactgcaacgagctggtgcccgtcacc
gagtacagcggcatcatctcgctctgcaagctctacacggtcctggccacaccagagaac
ggggtgaacccagctgatactgagaaccacgcctttatggtggagatgacgtttgtgttc
agcatgatctggtctgtgtgtgcctctgtggatgaggatggacgcaagaagattgacagc
taccttcgcgaaatcgagggctcctttcccaataaggacacagtgtatgaatactatgtg
aaccccaagatgcggacttggtcgtcatttgaggagcagctccccaagagctggcgttat
cctcccaacgcccctttctataagatcatggtacctactgttgataccgtccgatataac
tacctcgtgagcaccttggtggccaaccagaatcctgtcttactggtgggtcctgtggga
actggaaagacctccatagcccagagtgttctccagtccttgccttccagccagtggtca
gtgcttgttgtcaacatgtctgcacagaccacatcgaacaacgtgcagagcatcattgag
agcagagtggagaagcgaaccaagggtgtgtatgtgccatttgggggcaaaagcatgatc
acctttatggatgacctaaacatgcctgctaaggatatgtttgggtcccagccacccctg
gagctgatacgcctctggattgactatggcttctggtatgatcgtgtgaagcagaccatc
aagcacattcgagacatgttcctgatggctgccatggggcctccagggggtggacggact
gttatctccccgaggctgcagagtcgcttcaacatcatcaacatgaccttccccactgag
tcccagatcatccgcatatttggcaccatgatcaaccagaagcttcaggactttgaagaa
gaggtaaagcccattgggaacgtggtgacagaggctaccctagacgtttacaatacggtg
gtccagcgcttcctgcccacaccagccaagattcattacctcttcaacctccgagacatc
tccaaggtcttccagggcatgcttagagccaacaaggatttccatgacaccaaagccagc
atcaccagactctggatccatgaatgtttcagagtcttctccgacagactggttgataca
acagacatggaagctttcataggcatcttaagtgacaaacttggtaccttctttgacctc
acatttcatcatctctgtcccaacaaacgccctcccatctttggggacttcctgaaggag
cccaaggtctatgaagacttggtagatctgtcagtattgaagacagccatggagacagca
ctgaatgagtataatctgtctccttctgtcgtgcaaatgcagctggtgctcttccgagag
gccattgaacacatcactcggatcgtgcgtgtgatcggacagccccgaggcaacatgctg
ctggtggggattggaggcagtggaaggcagagtctggcccgcttagcctctagcatctgc
gagtacaacacattccagatcgaggtcaccaagcactaccgcaaacaggagttccgagac
gatatcaagcgcctgtatcgccaggcaggggtagaactccaggccacgtctttccttttt
gtggacacccaaatagccgacgaatccttcctagaggacatcaacaacatcctcagctca
ggcgaagtccccaacctctacaaggctgacgagtttgaagagatccagaaccaaatcata
gaccaggcccgggcagaacagatatcagagtcctcggacagcctctttgcatacctcatc
gagcgcgtgcggaacaacctgcacattgtgctctgcctaagtcccgtgggggaccccttc
aggaattggatccgccagtacccagccttagtaaactgtacaaccatcaactggttctca
gagtggccccgagaggccttgctagaggtggctgagaagtaccttgtcggagtggacttg
gggacacaggagaatatccacaggaaagtggcccagatctttgtcaccatgcactggtcg
gtggcccagtattcccagaagatgctactggagctgcggagacacaactacgtcacaccc
acaaactacctggagctcgtgtctggatacaaaaagcttctgggagaaaagcggcaggaa
ctgctggatcaagccaacaagcttcgaactggattgttcaagattgacgagactcgggag
aaagtcgaagtgatgtcgctggagctggaggacgccaagaagaaggtggctgagttccag
aagcagtgtgaagagtacctggtcatcatcgtgcagcagaagcgggaagctgacgagcag
cagaaggctgtcactgccaatagtgagaagatcgctattgaggaggtcaagtgtcaggca
ctggccgacaatgcccagaaggatctagaggaggcattgcccgcccttgaagaagccatg
cgggccctagagtctctgaacaaaaaggatataggtgagatcaaatcctacggacgaccc
cctgcccaggtggaaattgtaatgcaggccgtcatgattcttcgaggcaatgagcccacg
tgggcggaagcaaagcggcagttaggggagcagaacttcatcaagtcactgatctacttt
gataaagacaacatctcagataaggtgctgaaaaagattggggcctactgtgcccagccc
gacttccagcctgatatcattggcagagtctccctggcagctaagtccctctgcatgtgg
gtgcgggccatggagttgtatgggcgtctgtatcgagttgtggagcccaagcggatccga
atgaatgctgccatcgctcagcttcaggagaagcaagcagccctagctgaggcccaggaa
aagctgcgggaggtagcagagaaactggagatgctgaagaaacagtacgatgagaagctg
gcacagaaggaggagcttcgcaagaaatcggaagagatggagctgaagctggaacgggca
ggaatgttggtgtctgggctagctggggaaaaggcccgatgggaagagaccgtgcagggc
ctggaggaggatctgggttacctcgtgggtgactgtctgattgcagctgcgttcttgtcc
tacatgggaccctttctgaccaactaccgggatgagattgtcaaccaaatctggatcaag
aagatctgggagcttcaggttccctgttcacctcgctttgccattgacaacttcctgacc
aatcccaccaaagtccgggactggaacatccaggggttgccctcagattccttctccact
gaaaatggcatcatcgtcaccaggggcaacaggtgggccctcatgatcgatcctcaggca
caagccctcaagtggattaagaacatggaaggaaaccagggccttaagatcatcgacctg
cagatgcacgattaccttcgagttctagaacatgctatccagtttggatttccagtgcta
ctccagaatgtgcaagagtatctggacccttcgctcaacccagtgctcaacaaatctgta
gctcgaattggtggtcggatgctgatgcgcattgctgacaaggaggtggaatacaatccc
aatttccgtttctacctcaccaccaagctctccaacccccactacagtccagagacctcg
gctaagaccaccattgtcaacttcgctgtaaaggaacagggtctggaagctcaactgctg
ggcattgtggttcggaaggaacgaccagagctggaggaacagaaagattcgctggtcatc
aacattgctgcggggaagagaaagctcaaagagctagaggatgagatccttcgtttgttg
aacgaagccacaggctctctgctagatgacgtgcagcttgtgaatacccttcagacatcc
aagataacagctacggaggtgactgagcaactggagacaagcgagaccacagagatcaac
attgacttggcccgagaggcttaccgtccatgtgcccagagggcctcagtgctgttcttt
gtgctcaatgacatgggccgcattgaccccatgtaccagttctccctggacgcctacatc
agcctctttatcctcagcattgacaagagccatcgcagcaataaactggaggaccgcatc
gaatacctgaatgactaccatacttacgctgtctacagatatacctgccgaacccttttt
gagcgccacaagcttctgttcagttttcacatgtgtgccaaaatcctggagacgtctggg
aagctcaacatggacgagtacaacttctttctgcgtgggggtgtggttctggatcgggag
ggccaaatggacaacccatgtactagctggctggcagatgcctactgggataacatcacc
gagctggacaaactgaccaacttccatgggctcatgaactccttcgagcagtaccctcgg
gactggcacctgtggtataccaactctaacccggagaaggccatgctgccaggcgagtgg
gaaaacgcgtgcaacgagatgcagcggatgctgatcgtccgctccctgcgccaggaccga
gtggcattctgtgttacttccttcatcgtgtccaaccttggctctcgatttattgaaccg
cctgtgctgaacatgaaattggtgatggaggactctaccccacggtccccactagtattc
atcctgtcccccggggtggaccccaccagcgctctgctccagctggcagaacacacaggc
atggcccaccgcttccacgccctgtccctgggccagggccaggcccccattgctgcccgg
ctccttcgagagggtgtgaatcaaggacactgggtgttcctggcaaactgccacctgtca
ctgtcttggatgcctaacctggacaagttggtggagcaactgcaggtggaggaccctcac
ccttccttccgtctgtggctcagctctagccctcacccagacttcccaatctccatcctg
caggccagcatcaagatgaccacagagccaccaaagggtctgaaggccaacatgacgcgt
ctgtaccaactgatgacggaggcacagttcacgcactgctccaagcccaccaagtataag
aagctcctgtttgccctctgcttcttccactccatattactcgagcgcaaaaagttttta
cagcttggctggaacattatctatggcttcaacgactctgactttgaggtgtcagagaac
ctgctgagtctctatctggatgaatatgaggagacgccgtgggatgcactcaaatacctc
attgcgggtgtcaactacgggggacatgtcacagatgactgggatcggcgcctgctcacc
acctatatcaatgattatttctgtgacctgagcctaacgactccctcctaccggttgtct
gtgctggacacttactacatcccgaaggacgggagcttggcatcttacaaagaatacatc
agcttgctgcctagtatggacccccctgaggcctttggccaacaccccaatgctgacgtg
gcctcccagatcactgaggcccggaccctctttgagaccctgctttccctgcaaccccaa
attacacccaccaggattggtggccagagcagagaagagaaggtcctagagttggctgcg
gatgtaaagcagaagatccctgagatgattgactatgaggggacccggaagctgctggct
ctcgacccctccccactcaacgtggtcctcctacaggagatccagagatataacaagctc
atgaagaccatcttgttctcactgacagacttagagaagggtatccagggcctcattgtc
atgtcaacaagcctggaagagattttcaactgcatatttgatgctcatgtccctccgctg
tggggaaaggtatatccctcacagaagcctttggcgtcatggacccgggacctggctgtg
cgtgtggaacagtttgaaacatgggccaatcgagcccaccctcctgtgctcttctggctg
tccggctttactttccctactggtttccttactgctgtgctgcaatctgctgctcgacaa
aacaatatttcagtggacagcctttcttgggagtttatagtttccaccgtggacgacagc
aacctggtgtacccacccaaggacggcgtctgggttcggggcctgtacctggagggtgct
ggctgggaccggaagaactcttgtttagtggaggcagagcccatgcagttggtctgcctc
atgcccaccatccacttccgtccagcagagagccgaaagaaaagtgccaagggcatgtat
tcctgtccgtgctattattaccccaaccgggcaggcagcgcagaccgagcctcctttgtc
ataggcatcgatctccgatctggagccatgacatctgaccactggattaagaggggcact
gctctgctgatgagcctggacaactga

KEGG   Rattus norvegicus (rat): 360654
Entry
360654            CDS       T01003                                 

Gene name
Dnai2
Definition
(RefSeq) dynein intermediate chain 2, axonemal
  KO
K11143  dynein intermediate chain 2, axonemal
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    360654 (Dnai2)
   05016 Huntington disease
    360654 (Dnai2)
   05022 Pathways of neurodegeneration - multiple diseases
    360654 (Dnai2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    360654 (Dnai2)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     360654 (Dnai2)
SSDB
Motif
Pfam: YcaO
Other DBs
NCBI-GeneID: 360654
NCBI-ProteinID: NP_001007727
RGD: 1359602
Ensembl: ENSRNOG00000024523
UniProt: Q66HC9
Position
10
AA seq 619 aa
MEIVYVYVKKRSEFGKQCNFSDRQAELNIDISPNPELAALYVERNPVDTGIQCSASMSEH
EANTERFEMENCGVNHVEGGWPKDVNPQELEQTIRFRKKVEKDENYINAVMQLGSIMEHC
IKQNNAIDIYEEYFDDEEAVEVTEEAPSAKTINVFRDPQEIKRTATHLSWHPDGNKKLAV
AYSCLQFQRSPMGMSHDSYIWDLENPNRPEIALKPSSPLITLEYNPKDSHVLLGGCYNGQ
IACWDTRKGSLVAELSTIEFSHRDPVYGTIWLQSKTGTECFSASTDGQVMWWDIRKISEP
TEVVIMDITRKEQLENALGAISLEFESTLPTKFMVGTEQGIVISCNRKAKTPAEKIVCTF
SGHHGPIYALQRNPFYPKNFLTVGDWAARIWSEESRESSIMWTRYHMAYLSDGAWSPVRP
AVFFTTKMDGTLDIWDLVFKQCDPALSLKVCDDPLFCLRVQDTGCLIACGSELGTTTLLE
VSSSLSTLQRNERNIASSIFERETRREKILEARHREMRLKEKGKAEGRDDDQKEEETALD
LDELVNKAEEEFFEVIFAELKRKEAEALKKKPKPKKASIEVEGEDELEDIAGEEEESGII
MGEDTGEDDMDEKNEGGAP
NT seq 1860 nt   +upstreamnt  +downstreamnt
atggagatcgtctacgtgtacgtgaagaagcgcagtgagtttgggaagcaatgcaacttc
tctgaccgccaggctgagctgaacattgacatctcacccaaccctgagctggccgcactg
tatgtggagcggaacccagtggacacaggcatccagtgctccgccagtatgtcggaacat
gaggccaacacagagcggtttgagatggagaactgtggggttaaccacgtcgaggggggc
tggcccaaggatgtgaacccccaggagctggagcagaccatccgcttccggaagaaagtg
gagaaggatgagaattacatcaacgccgtcatgcagctgggctcgatcatggagcactgc
atcaagcagaacaatgccatcgacatctacgaggaatattttgatgacgaggaggccgtg
gaggtgactgaagaggccccttcagccaagaccatcaatgtcttcagggaccctcaggag
atcaagcggacagccacacacctctcctggcaccctgatggtaacaagaagctggccgtg
gcctattcctgcttgcagttccagcgctcgcccatgggcatgagccacgactcctacatc
tgggacctggaaaaccccaaccgacctgagattgccctgaagccatcgtctcctctcatc
accctggagtacaaccctaaggattcccacgttctcctagggggctgctacaatgggcag
atagcctgctgggatacccggaagggcagcctggtggcagagctgtccaccattgagttc
agccaccgagacccagtgtacggcaccatctggttgcagtcaaagacaggcaccgagtgc
ttctcagcgtccacggatgggcaggtcatgtggtgggacatccgcaagatcagcgagccc
accgaagttgtcattatggacatcaccagaaaggagcagctggagaacgccctgggcgcc
atctccttggagttcgagtctaccttgccaaccaagttcatggtgggcactgaacaaggc
attgtcatctcctgcaaccgcaaggccaagacgccagcggagaagatcgtttgcaccttt
tctggccaccacggccctatctatgccctccagagaaaccccttctacccaaagaacttt
ctgactgttggcgactgggctgcccgcatctggtctgaggagagtcgggagtcatctatc
atgtggacccggtaccacatggcttacctctctgatggagcctggagtcccgtgagacca
gcggttttcttcaccaccaagatggatgggaccctggacatctgggacttggtgttcaag
cagtgtgaccctgccctcagcctgaaggtatgtgacgacccactcttctgcctccgagtt
caggacaccgggtgtctcatcgcctgcggctccgagctcggaacaaccactctgctggag
gtctccagcagtctctctactctgcagaggaatgagaggaacatagcttcttccatattt
gaacgtgagacccggcgggaaaagatcctagaggccagacaccgcgagatgcggctgaag
gagaaaggcaaggcagagggcagagacgacgaccagaaggaggaggagacagccctggac
ctcgatgagctagtcaacaaagccgaggaggagttcttcgaagtcatcttcgcagagctg
aagaggaaggaggcagaggccttgaagaagaaaccgaaacctaaaaaagcaagtatagag
gtggaaggcgaagatgagctggaagatattgctggagaggaggaagaatccggcatcata
atgggtgaagatacaggtgaagatgacatggatgaaaagaatgagggcggggccccctag

KEGG   Rattus norvegicus (rat): 500442
Entry
500442            CDS       T01003                                 

Gene name
Dnai1
Definition
(RefSeq) dynein intermediate chain 1, axonemal
  KO
K10409  dynein intermediate chain 1, axonemal
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    500442 (Dnai1)
   05016 Huntington disease
    500442 (Dnai1)
   05022 Pathways of neurodegeneration - multiple diseases
    500442 (Dnai1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    500442 (Dnai1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     500442 (Dnai1)
SSDB
Motif
Pfam: WD40 DUF4191
Other DBs
NCBI-GeneID: 500442
NCBI-ProteinID: NP_001019513
RGD: 1565671
Ensembl: ENSRNOG00000013734
UniProt: Q5XIL8
Position
5
AA seq 705 aa
MPSKQIRKQSVILTRGARKREEDSGTDVGEGADDWAQSKAAVRPPDQLELTDAELKEEFT
RILTANNPHAPQNIVRYSFKERTYKLIGFVNQMAIHFSQVGNLIPKDSDEGRRQHYRDEL
VAGSQESVKVVTSDTEILEEEEEPKEGEGEGEGEAEGEAEAGSQTDVPAAAETTEKVIEE
ELMAPVQPKERKLTNQFNFSERASQTFNNPLRDRECQMEPPPRTNFSATANQWEIYDAYV
DELEKLEKTKEKEKTKTPVAKKTEKMAMRKLTSMESQSDDITKVTQAAKIVERMVNQNTY
DDVAQDFKYYEDAADEYRDQEGTLLPLWKFQNDKAKRLAVTALCWNPKYKDLFAVGHGSY
DFMKQSRGMLLLYSMKNPSFPEYMFSSESGIMCLDMHMDHPYLVVVGYYDGNVAIYNLKK
PHSQPCFRSTSKSGKHTDPVWQVKWQKDDMDHNLNFFSVSSDGRIVSWTLVKSELVHIDV
IKLKDEGSTTEIPEGLQLHTVGCGTAFDFHKEIDYLFLVGTEEGKIYKCSKSYSSQFLDT
YDAHNMAVDAVLWNPYHARVFISCSSDWTVKIWDHAIKTPMFIYDLNAAVGDVAWAPYSS
TVFAAVTTDGKAHVFDLAVNKYEAICNQPVVAKKKNKITHVQFNPIHPIIIVGDDRGHIT
CLKLSPNLRKMPKEKKGQEVQKGPAVEIAKLDKLLNLVREVKTKT
NT seq 2118 nt   +upstreamnt  +downstreamnt
atgccctcgaaacagattcgtaagcagagtgtcattttgaccagaggagccaggaagcga
gaggaagactcagggactgatgtgggagaaggagccgatgactgggcccaatccaaagcc
gctgtgcggccccctgaccagctggagctgactgacgcggagttaaaggaggagttcact
cggatcctgacagcaaacaacccacatgcaccccagaatattgtcaggtacagcttcaaa
gaacgcacatacaagcttattggttttgtgaaccaaatggcaattcacttcagtcaggtg
gggaacctgatacccaaagactcagatgaaggccgtcgacagcactaccgtgatgagctg
gtggcaggttcacaggagtcagtcaaggtggtgacttcagacacagaaatccttgaagaa
gaggaagaacccaaagaaggagaaggagaaggagaaggagaagcagaaggagaagcagaa
gctgggagccaaacggacgtacctgctgcagccgagacgactgaaaaggtgattgaagaa
gaactgatggctcctgtgcagcccaaggagcgaaaactcacgaaccagtttaacttcagc
gagcgagcatctcagaccttcaacaaccctctccgggatcgagaatgtcagatggagcct
ccacctcggacaaacttttcagccacagccaatcagtgggagatctatgatgcctatgta
gatgagctcgagaaactggaaaagaccaaagagaaggagaagaccaagactccagtggct
aagaaaacagagaagatggccatgaggaaactaacatctatggagtctcagagtgatgat
atcaccaaagtgacccaagctgctaaaatcgtggagcgaatggtcaaccaaaatacatac
gatgatgtcgctcaagattttaagtactatgaggatgctgctgatgaatacagggaccag
gagggtacgctgctgcctctctggaagtttcaaaatgacaaagccaagcgcctggccgtc
accgccctctgctggaatccaaagtacaaggatctttttgctgtgggacatggctcctat
gacttcatgaaacagagtcggggcatgctgctgctctacagtatgaagaaccctagtttc
cctgagtacatgttcagcagtgagagcggcatcatgtgtctggacatgcatatggaccac
ccctacctggtggtcgtgggctactatgacggcaacgtggccatctacaacctcaagaag
cctcactcacagccctgcttccgcagcacctccaagtctggcaagcacacggaccctgta
tggcaggtcaaatggcagaaggatgacatggaccacaaccttaacttcttttctgtgtca
tctgatggcaggatcgtgtcatggacccttgtaaagagcgagctggtccacatcgatgtt
atcaagctgaaggacgaaggcagcactacagaaatccctgaggggctgcagctgcacact
gtaggctgtggcactgcctttgacttccacaaagagattgactatctgttcctcgtgggc
acagaagaggggaaaatctacaagtgctccaaatcctactccagccagttcttggacacc
tatgatgctcacaacatggcagtagacgctgtgttatggaacccataccacgccagggtc
ttcatatcttgcagttctgactggacagtgaagatctgggaccacgccatcaagaccccc
atgttcatctatgatctgaacgcagctgtgggtgacgtggcctgggcaccgtactcttcc
actgtgtttgcagcagtcaccacggatgggaaggcccacgtgtttgacttggctgtcaac
aagtatgaagccatctgcaaccagcctgtggtggccaagaagaagaacaagattacccat
gtgcagttcaaccccattcaccccatcataatagtgggcgatgaccgtggacacatcacc
tgtctcaagctctctcccaacttacgaaagatgccgaaggagaagaaggggcaggaagtg
cagaagggtccagctgtggagatcgcaaaattggacaaactgctaaaccttgtgagggaa
gtaaaaaccaaaacctga

KEGG   Rattus norvegicus (rat): 685664
Entry
685664            CDS       T01003                                 

Gene name
Dnal1
Definition
(RefSeq) dynein light chain 1, axonemal
  KO
K10411  dynein light chain 1, axonemal
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    685664 (Dnal1)
   05016 Huntington disease
    685664 (Dnal1)
   05022 Pathways of neurodegeneration - multiple diseases
    685664 (Dnal1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    685664 (Dnal1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     685664 (Dnal1)
SSDB
Motif
Pfam: LRR_4 LRR_9 LRR_8
Other DBs
NCBI-GeneID: 685664
NCBI-ProteinID: NP_001102947
RGD: 1591349
Ensembl: ENSRNOG00000042333
Vega: OTTRNOG00000000833
UniProt: A0A096MJZ0
Position
6
AA seq 190 aa
MAKATTIKEALSRWEEKTGQKPSDAREIKLYAQIPPIEKMDASLSTLANCEKLSLSTNCI
EKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHVMRKLKIL
YISNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAEGNWIEEATKRVPKLKKLDGTP
VIKEDEEEES
NT seq 573 nt   +upstreamnt  +downstreamnt
atggcaaaagcaacaacaatcaaagaagccctgtccagatgggaagaaaagaccggtcag
aagccatctgatgccagagaaataaagctgtatgcccagatcccccccatagagaagatg
gacgcgtctctgtccacacttgctaactgcgagaagctttccctgtctacaaactgcatt
gaaaaaattgccaacctgaatggcctaaaaaacttgaggattctgtccttaggaagaaac
aacatcaagaacctaaatggactggaagcagtcggagacacactagaagaactgtggatc
tcctacaattttattgagaagttgaaagggatccatgtaatgaggaaactgaagattctc
tacatatctaataacctggtaaaagactgggctgagtttgtgaagctggctgagctgccg
tgcctggaggacctggtatttgtgggcaatcccctggaggagaagcattctgctgagggc
aactggattgaagaagctaccaagagggtgcccaagctgaagaagctggatggtactcca
gtaattaaggaggatgaagaagaggaaagctaa

KEGG   Rattus norvegicus (rat): 690288
Entry
690288            CDS       T01003                                 

Gene name
Dnah14
Definition
(RefSeq) dynein heavy chain 14, axonemal isoform X1
  KO
K10408  dynein heavy chain, axonemal
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    690288 (Dnah14)
   05016 Huntington disease
    690288 (Dnah14)
   05022 Pathways of neurodegeneration - multiple diseases
    690288 (Dnah14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    690288 (Dnah14)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     690288 (Dnah14)
SSDB
Motif
Pfam: AAA_6 DHC_N2 Dynein_C AAA_8 AAA_9 AAA_7 AAA_lid_11 MT Dynein_heavy Dynein_AAA_lid AAA_lid_1 AAA_18 AAA_16 AAA_22 TsaE Rad17 NTPase_1
Other DBs
NCBI-GeneID: 690288
NCBI-ProteinID: XP_038947405
RGD: 1582826
Ensembl: ENSRNOG00000051880
Position
13
AA seq 4606 aa
MESFIPVDLPVQKPDVNEKERNSRRRHLLYKDRWKDCGSSQNRLAKAKTSSESLISEGAD
DQDYYPDYLEQKFSRQCVVGSKPFLPDIKKAKEKPEKTARVRRKWPQVTLYDSTEPKETD
AVKHIIRLREKLEWENPSFPRSLKYSPKITAPKHTLKACLKDDGEFIYCLPLENTRGMFN
EYDLQAVSAHKAKNCKVFWMVSASFVSKITKTGVNTEEVELIPTVEWLSERHYFYLLLQF
KIFYNFRINKAFVTWKLNVKRQKTESSRSYLYSHLFSADELFQTSLLYVRGLCEDALTLK
KNKKDNPSAICLIKVDTSRTYSLEKFCEEQLQQATQAVVQLEEMRSKAIVEIKSTALKVA
EKKDVKEYFESKPAEIDTTHFKLPQYRCLLETNMKFLKLIDYLFQELIRQLMNSALNQLL
DLFTHSARTPFSKERRNESLMRDRKIFSRKISDDGEFVHSRLTAQDSELKQDTNVNETSN
RHTAKTDLKKAYAAIFEISFCLRTPTVSDSPEDLEENTQKTKQSREESLMYEEEQENRVR
TVSEDLLSQYYQPSKFGVLLKRILSDTGLLLESEQERFYNKLSEFPTNLFMEPNRLDFST
QFQNMIAAIEKYITTLVPLQRDPRLSTLVDLVSVPDLSNQTKGRVKYKKHAQWPDYYILF
DTDADYQNKIVSLLALIGNSVGLVSGYSYRFLKYCYMVEKAKVMCTKLPLMMNLTSIEFK
NIIHKFRSYLKQIVTMAVEMRLGIFCVKTLDYQLACLPYVDSIIQMSYNLLRCTIEDRSA
NLLEILESSLRQLDAEPIEVEQFVEHFNFLDEISSSVTQIEKDFCTITELYSVVRHYHVD
ISEEQIAIYKIIFMKFNYLKTSVKLVATSKEANLTKFRDSLEAYIVSLRVDVSNLKDKIR
SPILLSTSTPVQQAKDIIQSLSAETESLTLKVKTYSTYQDYYDYAHFHMNALNVDEFTQL
VMTEISDIECDLMLRKLLWEAQEEWGTYFWEWRNCTLQGIDIDVVKNNVSKWLHIIIVLE
KGLPKNDMVALLKQSVLDFKQELPIITALGNPYLKARHWEALQEITGKSISLDKSLSVEK
LLALKMFPYEKKIIEISVSATNEASLERMLFKVIELWNTSPLHLVPHITDGRSILIISST
DDLIAQLEDSQAILSTIKGSSYLRPIKHLVNEWNQNLTLFSQTIDEWMTCQRNWLSLEPV
FQSLEIQKQLAAETKIFSQVLLTWREIMSRVLNKLNALHITITTGILDSLKSCNGHLESI
KKSLEEYLELKRMNFPRFYFLSNDELLDILANSRDPESVQPHLVKCFENVRHVLLWKQGI
GPPSVKMLISAEGEGLVLPKKIRVRAAIEQWMVNVEKSMFDVLKKFITQGIEDWKFHTFS
DWVMSHPGQVVLTVSQIMFYNDCLKGFMSYNPREKLEAVHARVLHQLDDIAMLVTQNTSN
LRTKTMLAATLIIYVHCRDILTDLLVKNIFNMQDFEWCRHLQYKWNEKQKLCYVLQANTS
FVYGYEYLGCAPRLVITPLTERCWLSLSEALYFNLGGCTAGRAGTGKTETVKDLAKSFGK
HCVVFNCFEDLDYKIIGKLFFGLVQSGAWCCFDEFNRIDIEVLSVIASQILMIKDAKDSY
SVRFLLDGREVRINMSCAVLITLNPGYRGRVELPSNLKSLFRSVAMMVPHYKMITEVTLF
SFGFKSSKSLSGKIVSLYDLADKQLSKQEHYDFGMRTLKTVLIMTEKKKLEHKCTVGEHL
SELEESLIIIEAIQEASMSKFLPEDVLPFERIIEDVFPGITVSKTQHLALEKAIHSATEQ
LGLQQWPPQKAKIIQFYKQLQACVGVILVGPTGGGKTTVRKILEKALITLPVTSALPIKE
RQSDSKSTGKKGKVDVCVLNPKCITLGELYGQLNINTMEWNDGLLSAAIRNYVHINTTDY
SKKGSDLGMSGVTDLSNIFQVSFSTIADMDNNIFMNKLEKSFKTPETYDFDWQWIVLDGP
VDILWIENLNTVLDETRTLCLANSERISLTNKIRLVFEVDTLFNATPSIVTRCAVVYMDP
VDLGWEPYIKSWLLRTSKSLNQQGMQCLEIMINKSVDEGMKFLKKHKKFLPCPIQEVTVV
MTLCRILDAFFEFMHIKRETPKSHEATDNGSPTETKALRVKFKEEKSYNKDERTWFLERN
PEKLPLMIQKIFVFAFTWAFGGILKREDQHEEDLLFRSDFEHDSPAEVTYNFDNFAREVF
EDDSDKGIGIRLPGSEQSIFGYFVDLQQCEFMPWSDLVPNAQTLIQKGTSVLTDFQRSGE
NVLRMKEYGEYVNYTATRDTVCLSFLMSLLLRNSCPVLLTGDCGVGKTTAINRMLEKLEG
QGTFDIKYGSILGKVLLHNEIKRSSLRQNINVLIGETGKVVGVGLDQGAKTEEDKGDDDS
TVKNDKGIIVSTVNFTTTMTAAKTKELILQKLVRKTKDILGAPKNNRIVVFIDDLNMPLP
DECGAQPPLELIRQLLDMGGIYDTERNVWKSIQDLSLIAACTPSAGGKDISPRLLKHFSV
LVLPHPPQSVLCTVFQAHLGLYFSLHNFVTEVQKCRDQIVFCSLAIYYEVCKKMLPTPTK
CHYIFNPRDMFKLLLGLMQADKSVINSKETVALLLVHEASRVFHDRLIEPKEKSLFYQIL
STELQNHMQVSWSQESLMNNPVLFVDFMDVNKPHRKRIYQNTDNYDKLLNILTEFQQKLG
STSLEMSHSVVFFKEAIEHITRTTRVLRQPGSHMLMIGMDGCGKETYGTIACYVAEYKIC
KVPISHNYAISEFKEMLKKVFIQAGLEETPTVVMVANLLEEHVSFLEDLNYIINAGKISN
MFENEELDSIVMRVRTFAEQSSCMDDRKYLLSLFQKRVSKNLHVCMMCTTGPNFRHSCRV
YPSMISSCTIDWFQRWPDEAFLIVANSYLEEKLNVENKENKIRQFAPTCVEIHKSMKDLS
IKYFEETGRHYYITPSCYFKFLETFTHSLRVRQEEMQTKRNRFYMGLSKILEATALVTDM
QEELLVIGPQIEQKAKEKEILMEKLRKDSQIVEKVQVLVKQDEEIVAEQVKIVEDYAQKT
ANELKSVLPSLDKAIVALNALDKSDISELRVYTRPPYLVLTVMNAVCILLEKKPNWTTAK
LLLSDTSFLKRLINLDKDSIPDKVFLRLKKILNLPDFNPSKIAMVSVACCSMCQWVIALN
NYHEVQKVVRPKQAQVAEAQNVLQIAKQRLFEKQRGLQLIEEHLQFLHTSYRDIVTEKHQ
LANRKKLATKRLQCASVLLTVLEDEKIRWQETINEIDNKLKGICGDIFLSSACLAYSGVL
TPEFRQLVMQKWKDFCTQAEIILSPNFSLIDVMAEKNEIRRWHNQGLPLGQHSAENAILM
KSTKQWPLLIDPHKQALCWIRQMEGSRLQEISAQDSNYTKKLVFAMQSGDSVLLQNIPEM
FPPTLRAMLKKDICQTRGQSYIRIDDTEIEYNEKFRLYLSTELENPHFFPSVYNFVTIIN
FTVTFQGLQDELLSTVVSHEVPHLENQRAQLLESISLDAITLEELEDKTLTLLQKTEGSV
LDDEEIVETLRKSKITSNEISKRIKKTEKAESEIQATRKNYLPIATRGALLYFVVASLRQ
VGYMYQFSLEWLRKVFVSSTVSKTKDEKPDWKTDDTSQEKVDEVSLSPSDQENLESERTP
LAENIKNVIDTLTRNVFKVVSSALFNEHKLCFSFRLCTTIMRDHSSDTLTADDIGFLPEE
EWNIFLYTGILINIKNIFSKPRLNSIFEIRRKEHLQWVLDLRWRQCQYISNQMESFSLLC
KSLLSNEQQWNAFRDSKAVYSLLSLPFFSDEPSLQKTPRSAKEAELLDENDEMLHPITFP
WEKLTQFQRLILIKILRPDRLESSIKKFITEKMGSEYIPDTTINLKESFSESTAQTPLIL
TCSYGIDLNNLLLRFAQEFKGTTPQVTMISLGRDQATKAEQLIFKAVKKKHQWVFLQNCH
LAASFMPRLTAIIDSFSSPDMVLDPDFRLWLSSRAYGFFPITILQKGVKIAVEPPQGLKS
NLLQMFGYGGSGEVTEEVFDKPDCGPWWKKILFSLCLFSAVLNERKAYGTLGWNIPYQFS
SSDLEVSIKVLANVLSGQSEVPWKEVNYLISEVTYGGRVTDEWDKRCLKALFYKFCNPEI
LKDNFSFSSNVMYQAVPSSASLKDCISIIQSFPDDDSPEILGIHPEATYTCNEIKAQKYI
ENLICMQPKDAPGTPMINPEQSNDDLVMEILSDIMMQLPLTVENEEVSGLENQCTFKFIM
SSPMWEKLHENIQGEQQLWAPPTWQPGASPGYDPLIHSVLIPFLKNEIERFNKLLSVIHK
SLKDLQLSIKGESILTPDLEETYDSFLRARVPMLWQKNAYKSCRPLSFWVSNLIQRVNFF
NTWAKVAYTTIHHRYMMFITTWKRLGQKSKHYPDSGSEVTEGFPARYWLSAFFSPQAFLT
AVLQDYGRAQGISMDALTFTHKVIYNSDGSQEDDLSKFLQKRLNIVKRAFQQHQEHHHEG
VYIFGLYIEGARWDPQQEVLEDALPAQLCCEFPDIHFLPTKITEIPEDSDQSELQTFECP
VYYTPERTRNATGLPTSLLTSVHLPTKKPPSHWITMQVALLCEKNE
NT seq 13821 nt   +upstreamnt  +downstreamnt
atggagtcgtttatacccgttgacctgccagttcagaagccagatgtgaacgagaaggaa
cgcaactcaagaagaagacatttactatataaagaccgttggaaagattgcggctcatct
cagaacagactagctaaggcgaagacatcctccgagtccctgatatcagaaggagcagat
gaccaagattactacccagattaccttgaacaaaagttcagtcggcaatgcgtagtgggt
tcaaaaccgtttctccctgatataaagaaggcaaaagaaaagccggagaagaccgcccgt
gtaagaaggaaatggccccaagtcacgctgtacgacagcacagaaccaaaagagactgat
gctgtaaaacacattattaggctgagagaaaagctggagtgggaaaacccctcatttcca
cgttctttgaagtacagccctaagatcacggctccaaagcacaccctaaaggcatgcttg
aaagatgacggcgagttcatatactgccttcctctggagaacaccagaggcatgttcaat
gagtatgatcttcaagcggtctctgcccacaaagcgaaaaactgcaaagtgttttggatg
gttagtgcttcatttgtctcaaagatcactaaaacaggagtcaacacggaggaagtggaa
cttatacccactgtggagtggctctcagaacgacactacttctatttactactgcagttt
aagatcttttacaacttccggataaataaagcctttgttacttggaaactaaatgttaaa
agacagaagacagagtccagcagatcatacctgtacagccacctgttctctgctgatgag
ttattccaaacttctttgctttatgtgagaggactctgtgaagatgccctgactctcaaa
aagaacaagaaagacaacccatccgccatctgcctcatcaaggtggacacttcccgaacg
tacagtctggaaaagttttgtgaggagcagttacagcaggccacccaggcagtggtgcag
cttgaggagatgaggagtaaagcaattgtggagataaagagcacagccttgaaggtcgca
gaaaagaaagacgttaaggaatactttgagtcaaaaccggctgaaatcgacacaactcac
ttcaagctgccccagtatcgatgtttattagaaacaaacatgaagtttttaaagctgatt
gactacctgtttcaagaactcattcgccagctcatgaactctgcactcaaccagctcctg
gaccttttcacccactctgccaggacaccattttccaaggaaagaaggaatgaaagtctc
atgagagacaggaagatcttttctaggaagatatcagatgatggtgaattcgttcattca
aggttaactgctcaagactcagaactaaaacaagacactaatgttaatgagacttcaaac
agacatactgcaaagacagatttgaagaaagcatatgcagcgatatttgagatcagcttc
tgtctgagaactcccactgttagcgactctccagaggaccttgaagagaatactcagaag
acgaagcagagccgtgaagagtctctgatgtatgaggaagaacaggagaaccgagtgaga
acagtgagcgaagacctgctcagccagtactaccagccgagcaagtttggcgtcctcctc
aaacgcatcctttcagacacaggactcctgcttgagtctgagcaagagcgcttctataat
aaattgtctgaattcccaacaaacctcttcatggaacccaacagactggacttttcaaca
caattccaaaatatgatagcagcaatagaaaagtatataaccacactcgtccctcttcaa
cgagatcctcgcctgtccacccttgttgatttggtttcagttccggatttatctaatcag
acaaaaggtagagtcaaatataagaagcatgcgcaatggccagattactatatcctgttt
gacacggatgctgattaccagaacaaaattgtgagtctgctggccctcattggtaattca
gtgggcctggttagcggctacagctacaggtttctgaaatactgttacatggtagaaaag
gccaaagtcatgtgtacgaaactgccactcatgatgaacttaacgtccatcgagtttaaa
aatataatacataagttcagaagctacctaaagcagatcgtcaccatggctgtcgagatg
cgccttggaatcttctgtgtgaagactctggattatcaactagcatgtttgccgtatgtt
gatagcatcatacaaatgagctacaacctgttacgatgcaccatcgaggacagaagtgca
aatctattagaaattttagaatcctcgctgcgccagctggacgcagagcccatagaggta
gagcagtttgtggaacacttcaatttcttggatgaaatttcctcgagcgtaactcaaata
gaaaaggacttctgcacgattactgagctgtattccgttgtgaggcattaccacgtcgac
atttcagaggagcagattgccatatacaaaatcatcttcatgaagtttaactatctgaaa
acgtccgtgaagctggtagccaccagtaaagaagccaacctgaccaaattcagggacagt
ttggaggcatatattgtcagcctgcgagtggacgtcagtaatttaaaagataaaataaga
agccccatcctgctgtccaccagtactccagtacaacaagccaaggacatcatacagtcc
ctctcagcggaaactgaaagcttgactctaaaggtgaaaacatactcaacctaccaagac
tattatgattacgcccatttccacatgaacgctctcaatgtggacgagttcacccagcta
gtgatgacggaaatctccgacatcgagtgtgacctgatgctgaggaaattattatgggaa
gcgcaagaggaatgggggacatatttctgggagtggaggaactgcactctccaaggcatt
gacattgatgtagtgaagaacaacgtctccaagtggctgcacataatcattgtactggaa
aaaggcttgcctaagaatgatatggtagcgctgctgaagcagtcggtgttagacttcaaa
caagagctgccgatcatcacagcactgggaaacccctatctcaaggcccggcactgggag
gctctgcaagagatcactggaaagtcgatctctcttgataaaagcctctcagtagagaaa
cttctggctctcaagatgtttccgtatgaaaagaaaatcattgaaatatcagtatcagca
actaacgaagcctctctggagaggatgctgttcaaggtcatcgagctctggaacacgtct
cccttgcacctggtcccacacatcaccgacggccgctccattctcatcatctcatccact
gacgacctgatagctcagctggaggactcccaggccatcctttcaaccatcaaaggatct
tcgtatctcaggccaattaagcatcttgtgaatgaatggaatcaaaacttgaccctcttc
tctcagaccattgacgaatggatgacctgtcaaagaaattggctttctcttgaaccagtc
tttcagtctttagaaatacagaaacagctggcggcagagacaaaaattttctcccaggtg
cttctcacatggagagaaataatgtctcgcgtactgaacaaactaaatgccctgcatata
accatcaccacgggaatcctggacagtctgaaaagttgcaacggacatcttgagagcatc
aagaaaagtctcgaggaataccttgaacttaaaagaatgaatttcccgagattttacttc
ctcagcaacgatgaacttcttgatattctagctaacagcagagatcctgaatccgtacag
cctcaccttgtgaaatgttttgaaaatgtaagacacgtgctactgtggaaacagggcatc
ggccctccctctgtgaagatgctcatctctgctgaaggggaaggcctggtgctgcccaag
aaaatccgtgtaagagccgctatagaacagtggatggtaaatgtagaaaaaagcatgttc
gatgtgctaaagaaatttataactcaaggtattgaagactggaaatttcatactttttct
gactgggtcatgtcacatccagggcaagtggtcctcactgtgagccagattatgttttat
aatgactgtttgaaaggcttcatgagttataatccaagagaaaaactagaggcagtccac
gcccgtgtgctgcatcaactggatgacattgcgatgctggtcacgcagaataccagcaac
ctgcgcacaaaaaccatgctggcagcaacgctgatcatctacgtccactgcagagacatc
ctgaccgatctgctagttaagaacatcttcaacatgcaggactttgagtggtgcaggcat
ctgcagtacaaatggaacgaaaagcagaagctgtgttacgtcctccaggcaaacaccagt
tttgtttatggctatgagtacttgggctgtgccccgagactggtcatcacccccctcaca
gaacggtgctggctttccctctctgaggcgctgtacttcaacctgggaggctgcaccgct
gggcgcgcaggtaccggaaaaactgagactgtgaaggacctggcgaaaagctttggtaaa
cactgcgtggtcttcaactgttttgaagatttggattataagataattgggaaattattc
ttcgggttggtgcagtcaggagcttggtgctgttttgatgaattcaaccgaatcgatata
gaagtcctctccgtcattgcctcccagatcctgatgatcaaggatgccaaagacagctat
tctgtcaggttcctgctggatggtagagaagtacggatcaatatgtcatgcgcggtgctg
atcaccttaaatcctgggtatagaggtcgggttgagctcccaagcaacttaaaatccctg
tttcgctcagtggccatgatggtgccccactacaaaatgatcactgaagtaactctgttt
tcatttggcttcaaatcttcaaaatctctgtctggaaagatagttagcctttatgattta
gctgacaagcagctctcaaaacaggagcactatgattttggcatgaggaccttgaagaca
gttttaataatgacagaaaagaagaaactggagcataaatgtactgtcggggagcatctc
tccgagctagaggagtcgctgatcatcatcgaggccatccaggaagccagtatgtcaaag
ttccttcctgaagatgtcctacctttcgaaaggatcatagaagatgttttccctggaata
acagtttcaaaaacgcaacaccttgccttggagaaagcaatacacagtgcgacagaacaa
ctaggccttcagcagtggccgcctcagaaagcaaagatcatacaattttataagcagctt
caggcatgtgttggcgtgattctagtgggcccaacaggcggagggaagacaacagtcagg
aaaatcttagagaaagcattgataacattgcccgttacttctgccttacccattaaagaa
aggcaatctgactctaagtctacagggaagaaaggaaaagttgatgtttgtgttttgaat
ccaaaatgtatcactcttggtgaactgtacggacagctgaacatcaataccatggagtgg
aatgacgggctattgtcagcagcaattcgaaactatgtccatattaacactacagattac
tccaagaaaggcagtgatcttggaatgtcgggagtcacagatttgtctaacattttccaa
gttagtttctctacaatagcagatatggataacaacatttttatgaacaaactagagaaa
agtttcaagactccagaaacttatgattttgactggcagtggatcgttttggacggccca
gtcgacatcttatggatagagaatctaaacactgtgcttgatgaaacaagaacgctgtgc
ctggcaaacagtgagaggattagcctgactaacaagatcagactggtgtttgaggtggac
actctctttaacgccaccccctctattgtcacccggtgcgcggtggtgtacatggaccct
gttgatctgggatgggagccttacattaagtcatggcttctgagaacttcgaaaagccta
aatcagcagggaatgcagtgtctcgaaattatgattaataaaagtgttgatgaagggatg
aaattcctgaaaaagcataaaaagttcctaccctgccccatacaagaagtgacggtcgtt
atgactctatgcaggattctagatgctttttttgaattcatgcatataaaaagagaaact
ccaaaaagtcatgaagcaacggacaacgggtcccctaccgagacaaaggctttaagagtc
aagttcaaggaggaaaagagctacaacaaggatgagaggacgtggttcctggagagaaac
cccgagaagctcccactgatgattcagaagatattcgtgttcgcattcacgtgggcattt
ggagggattttaaagcgtgaagaccagcatgaagaagacctgctgttccgttcagacttt
gagcatgactccccagcagaagtaacctataattttgacaactttgcccgtgaagtattt
gaagacgactctgataaaggcattggtattcgcttaccaggaagtgagcagtctatattt
gggtattttgtggacttacagcaatgtgagtttatgccttggtcagatttagttcctaac
gctcagaccctaattcaaaaagggacatcggtacttaccgacttccagcgatctggtgag
aacgtgctgaggatgaaggagtacggagagtacgtgaactacactgctaccagagacacc
gtctgcctctctttcctcatgagccttctcctgaggaactcctgccctgtacttctcaca
ggagactgtggtgttgggaagactactgccatcaacaggatgcttgagaagctagagggc
caaggaacattcgatatcaaatacgggtcaatcttaggaaaagtcctgttgcataatgaa
attaaaagatcaagcctcagacagaatatcaacgtcttgattggtgaaaccggcaaagta
gttggcgtaggtcttgatcagggtgcaaagacagaagaggataaaggtgatgatgacagc
accgttaaaaatgataaagggattatagtctccacagtaaacttcaccaccaccatgacg
gccgccaaaaccaaggagctgattctgcagaagttagtgagaaaaaccaaagacattctg
ggagcaccaaagaacaaccggattgtagtatttattgatgacttgaatatgccactacca
gacgaatgcggagcgcagccacccctggaattgatcagacagttattagacatgggaggc
atttatgacacggaaagaaacgtgtggaagagtattcaagatctttctctaattgctgct
tgtacaccttctgccggtgggaaggacatcagcccccgtctcctcaagcacttctccgtg
ctggtgttgcctcaccctccacagagtgtcttgtgcactgtttttcaggctcacttgggg
ttgtatttctccctccataacttcgtaactgaggtgcagaaatgcagagatcagattgtc
ttctgctccctggcgatatattatgaagtctgtaagaaaatgttgccaacaccaaccaaa
tgccactatatattcaatccccgagacatgtttaagcttctgctaggattgatgcaggca
gacaagagcgtaattaactccaaagagacggttgctctgctcctagttcacgaagccagc
cgtgtgtttcatgatcgtttgattgaacccaaagaaaaaagccttttctatcagatcctg
tcaacagaactccagaatcatatgcaggtttcctggagccaggagagcctgatgaacaac
ccagttttatttgtggacttcatggatgtaaataagcctcaccgaaaaaggatctaccag
aacactgataactatgacaaacttctcaacatcctcaccgaattccaacagaagttgggg
tccacatccctggagatgtctcattcggtcgtattcttcaaggaagctatagaacatatc
acaagaactaccagggtccttcgacagccaggaagtcacatgttaatgattggaatggat
ggctgcgggaaggaaacttacggaaccatagcctgctacgtggcagaatacaaaatatgc
aaagtgcctatctctcacaactacgccatctcagagttcaaagaaatgttaaaaaaggtg
tttatccaggccggcttggaagagacccccacggttgtcatggttgccaacttactggaa
gaacacgtgtcatttctggaagatttgaactacattatcaatgctggaaagatttctaac
atgtttgaaaacgaggaactagattctatcgttatgagagtcaggacatttgctgagcag
tctagttgcatggatgatagaaaatatttactctctttattccaaaagagagtatctaaa
aatctgcacgtttgtatgatgtgtacgactggacctaacttccgccatagctgccgagtt
tacccctctatgattagctcctgcaccatcgactggttccagaggtggcccgatgaggct
ttccttattgtggccaactcctacctagaagaaaagctgaacgtggagaacaaagagaat
aagataaggcagtttgccccaacgtgtgtcgaaatccacaaaagtatgaaagacttgagc
ataaaatactttgaagaaacgggaagacactattacatcactcccagttgctactttaag
ttcctggagacatttacccacagtctgcgggtgagacaagaagaaatgcagacaaagagg
aatcgcttctacatgggactttccaagatcctggaggcgactgcactggttacggacatg
caggaggaactcttggttatcggtcctcagatagaacaaaaggcaaaggaaaaagagatc
ttgatggaaaagctgcggaaagactctcaaatcgtggaaaaggtgcaggtgcttgtgaag
caggatgaggagattgtggctgaacaagtgaaaattgtggaagactatgctcagaaaact
gccaacgagctgaaaagcgtgctgccttctttagacaaggcaatcgtggccctcaacgcc
ctggataaaagcgatatttccgaattgagggtctacacacgccctccctaccttgttctg
accgtcatgaacgccgtgtgcatccttctagagaagaagcccaactggacaacagcaaag
ctgctgctctcggacaccagcttcctaaagcgactaattaacctggacaaggacagcatc
cccgataaggtgttcttgaggctcaagaagattttaaatctgcctgacttcaaccccagc
aagattgctatggtttctgtggcttgttgctccatgtgtcagtgggtgatcgccttgaac
aactaccatgaagtacagaaggtggtgcgtcctaagcaggcacaagtggcggaggcacag
aacgttctccaaattgcaaagcaaaggctgtttgaaaagcaaagaggtttacaactgatc
gaagagcatctgcagttcttgcacacatcctacagagacattgttactgagaaacatcaa
ctggcaaatcgaaaaaagctggccaccaagcgcctccagtgcgcatccgtcttgctgact
gttctggaggacgagaagattcgatggcaagaaacaatcaatgagatagacaacaagttg
aaaggcatctgtggcgacatatttctctcatccgcatgccttgcctacagtggagtcttg
acgccagaattccggcagctggtgatgcagaaatggaaagacttctgcactcaggccgaa
atcatcttgtcacccaatttttccttaattgatgtgatggcagaaaaaaatgagatccgc
cggtggcataaccaagggctgcctctcggccagcactcagcagaaaatgccatcttgatg
aaaagtacgaagcagtggccactgttgatcgacccacacaaacaagcgctctgctggatc
cgccagatggaaggatccaggctgcaagagatttctgctcaagatagcaattacaccaag
aaacttgtgttcgctatgcaatcaggagactcggtcctcctgcagaacatccctgaaatg
ttccctcccaccctgagggcaatgctgaagaaggacatttgccagacaagagggcagtcc
tacatcagaattgacgatactgaaattgaatacaacgaaaagttcaggttgtacttatct
acagaactagaaaacccccattttttcccatccgtttataacttcgttactatcatcaac
ttcacggtgacattccaaggcttgcaagatgaactcctgtctacagtagtaagtcacgaa
gttccgcacttagaaaatcaacgggcccagttattggagagcatttctcttgatgccata
actctggaggaactggaggataaaacattgaccttgctccagaaaacagaaggaagtgtg
ttagatgatgaagagattgtagaaaccctgagaaaatccaaaattacttccaatgagatt
tccaaacgcatcaaaaaaacagaaaaagcagagagtgaaattcaagcaactcgcaagaac
taccttcccatcgccacgcggggcgccctgctttacttcgtggtggccagcctcaggcag
gtggggtatatgtaccagttctccctggagtggctccggaaggtttttgtttcctctaca
gtttccaaaaccaaagacgaaaagcctgattggaagacagatgacacttctcaggaaaaa
gtcgatgaggtttccctaagtccctcagaccaagagaacctggagagtgagaggactccc
ttagctgagaatatcaaaaatgtgatagacacgctgacaagaaatgtgtttaaggtggtc
tcttcggctctatttaatgagcataaactctgcttctccttccgactttgcacgaccatc
atgagggatcattccagtgacactctgacagcagacgacataggattcctaccagaagag
gaatggaacatctttttatatactggcattttgataaatattaaaaatatattctccaag
cctagactaaatagtatctttgaaatacggagaaaggagcatctccagtgggtgctggac
ctcaggtggagacagtgccagtacatcagcaaccaaatggagtccttctccctcctgtgc
aagtcactcctgtcaaatgagcagcagtggaacgccttcagggactcgaaggccgtgtac
tccctactaagcctgcctttcttctcagatgaaccctcacttcagaaaacacccagatcg
gcgaaggaggccgaacttctggatgaaaatgacgaaatgcttcaccctataacttttcct
tgggaaaaactcactcaatttcaaaggcttatcttgattaaaattcttcggccagaccgt
ttagaaagttcaataaaaaaatttataactgaaaaaatgggaagtgaatatatccccgat
actacaattaatctgaaagagtcatttagcgagtctactgctcaaacaccactgatcctc
acctgctcctacgggattgacctcaacaatcttcttctgagatttgcacaagagttcaaa
ggaacgacaccgcaggtgaccatgatttccctgggccgagaccaggcgaccaaagcggag
caactcatttttaaggcagtgaaaaaaaagcaccagtgggtcttcctccagaactgccac
ctcgcagcgtccttcatgccaagactcactgccatcatagactcatttagtagtccagat
atggtgctagatcctgactttaggctctggctgagctcaagagcctatggctttttccca
attacgattcttcagaagggcgtgaagattgctgtggaacctccccagggattgaaaagc
aatttacttcaaatgtttggctatggtggaagtggagaggtgacagaagaggtgtttgat
aagcctgattgtggaccatggtggaaaaaaattctcttcagcctctgtcttttcagtgct
gtgctcaatgaaaggaaagcgtatggaacactgggctggaacatcccttaccaattcagt
tcctcagacctggaggtgtccataaaggtgctcgcaaatgtcctctccggtcagtcagaa
gtcccatggaaggaagtgaactacctgatctcggaagtgacctacggtggccgggtgact
gatgaatgggacaagcgatgcctgaaggctcttttctacaaattctgcaatcctgaaata
ctaaaggataacttcagtttctctagcaatgtgatgtaccaagcagtgcccagctccgca
agcttaaaggactgcatcagcattatccagtcctttccagatgatgactctcccgaaata
ttaggaatccatcccgaagccacatacacctgcaatgagatcaaggcccagaaatacatt
gaaaatctcatctgtatgcaaccaaaagatgccccaggcacccccatgatcaacccggaa
cagagcaatgatgacctagtgatggagatcctatctgacataatgatgcagttgcccctg
acggtggagaatgaggaagtttccggacttgaaaaccaatgcactttcaaattcattatg
tcaagtccaatgtgggagaagcttcatgaaaatattcaaggtgagcagcagctctgggct
cctcccacgtggcagccgggagcctctccaggatatgatccccttatccactctgtcttg
atccccttcctgaaaaatgaaatagaacgtttcaacaagttattgtctgtcatacataaa
tccttaaaggaccttcagctctctataaagggagagagcatcctcactccggacctggag
gagacctatgactccttccttcgggccagagtgcccatgctgtggcagaagaatgcctac
aaatcctgcaggcccctgagcttttgggtgagcaacctcatccaacgagtgaacttcttc
aacacctgggccaaagtggcctacaccaccatacaccatcggtacatgatgttcatcaca
acctggaaacggcttggccagaaatccaaacactaccctgactctgggagcgaagtcact
gagggttttcctgcacgatactggctgtctgctttcttctctccacaagcttttcttact
gccgtgcttcaagactatggaagggcccaaggaatctccatggatgccctcactttcact
cacaaagtaatttataatagtgatggcagccaagaggatgacctctccaaatttctccag
aagaggctcaacatagtcaagagagctttccagcaacaccaagagcaccatcacgaagga
gtctacatttttggtttgtacattgagggagcacgatgggatccgcaacaggaagtgctg
gaagacgcactgcccgctcagctgtgctgcgaattccctgacatccacttcttgccaaca
aagattactgaaatacctgaggattccgaccagtcagaactgcaaacttttgaatgtcca
gtttactacacacctgagaggacaagaaacgctactggtttaccgacaagtcttttgaca
tcagtgcatttaccgacgaagaagcctccgagccactggatcaccatgcaggtcgcactg
ctatgtgagaagaatgaatga

DBGET integrated database retrieval system