KEGG   Rattus norvegicus (rat): 117255Help
Entry
117255            CDS       T01003                                 

Gene name
Ptpn12, Ptpg1, RKPTP
Definition
(RefSeq) protein tyrosine phosphatase, non-receptor type 12
  KO
K18024  tyrosine-protein phosphatase non-receptor type 12/18/22 [EC:3.1.3.48]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    117255 (Ptpn12)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     117255 (Ptpn12)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    117255 (Ptpn12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase Y_phosphatase3 DSPc
Motif
Other DBs
NCBI-GeneID: 117255
NCBI-ProteinID: NP_476456
RGD: 620894
Ensembl: ENSRNOG00000013135
UniProt: G3V7Q4 Q63745
Position
4q11
AA seq 766 aa AA seqDB search
MEQVEILRRFIQRVQAMKSPDHNGEDNFARDFMRLRRLSTKYRTEKIYPTATGEKEENVK
KNRYKDILPFDHSRVKLTLKTPSQDSDYINANFIKGVYGPRAYVATQGPLANTVIDFWRM
IWEYNVVIIVMACREFEMGRKKCERYWPLYGEDPITFAPFKISCENEQARTDYFIRTLLL
EFQNESRRLYQFHYVNWPDHDVPSSFDSILDMISLMRKYQEHEDVPICIHCSAGCGRTGA
ICAIDYTWNLLKAGKIPEEFNVFNLIQEMRTQRHSAVQTKEQYELVHRAIAQLFEKQLQL
YEIHGAQKITDGNEISTGNMVSSIDSEKQDSPPPKPPRTRSCLVEGDAKEEILQPPEPHP
VPPILTPSPPSAFPTVTTVWQDSDRYHPKPVLHMASPEQPPTDLNRNYDKSADLMGRSES
AVEHTDKKLEQNLSFEIKKVPLQEGPKSFDGNTLLNRGHAIKIKSASSSVVDKSSKPQEL
SSGDLKVHDVSQNSCADCSASHLDNAPESSEESQNSHTPPRPDCLPLDKKGHVTWSLHGP
ENATPVSDSPDNHSQTLKTVSSTPNSTAEEESHDLTEHHNSSPLPRAPLSFTNPLHSDDS
DSDEGNSDGAVTKNKTSISTASATVSPASSTESACTRRVLPMSIARQEMAGRRHSGAEKD
ADVSEESPPPLPERTPESFVLADMPIRSDWHELPSQECSEHRESEGLITSGNDKHDAGVS
HTAACSPTFSDKKEEITESLTEVTDIGFGNRCGKPKGPRDPPSEWT
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atggagcaagtggagattctgaggaggttcatccagagggtccaggccatgaaaagtccg
gaccacaatggggaggacaacttcgcccgggacttcatgcgattgagaagattgtctacc
aaatatagaacagaaaagatttatcccacagccactggagaaaaagaagaaaatgttaaa
aagaacagatataaggacatactgccatttgatcacagccgagttaagttgactttgaag
acaccatcccaagattcagattatatcaatgcaaattttattaagggtgtatatgggccg
agagcatacgtggcaacccaagggcctttggcgaatacagtcatagacttctggaggatg
atatgggagtacaatgtggtgatcattgtaatggcctgtcgtgaatttgagatgggaagg
aaaaagtgtgagcgctattggcctttgtatggagaagatcctataacatttgcaccattt
aaaatttcttgtgaaaatgaacaagcaagaacagactacttcattcgaacacttttactt
gaatttcaaaatgaatcccgtcgactctatcagtttcattacgtgaactggccagaccat
gatgtcccttcgtcattcgattctatcctggacatgataagtctaatgaggaagtaccaa
gagcacgaagatgtgcctatttgtatccattgcagtgcaggctgtggacggacaggtgct
atttgtgccatcgactacacgtggaacttactgaaagcagggaaaattccagaggaattt
aatgtatttaatttaatacaagaaatgagaacacaaaggcactctgcagtacaaacgaag
gagcagtatgaactcgtccatagagctattgcccaactgtttgaaaaacagctacaactg
tatgaaatccacggagcccagaaaatcactgatggtaatgaaattagcactggaaacatg
gtcagttccattgatagtgaaaaacaagattctcctcctccaaagccaccacggactcga
agttgtcttgtagagggggatgccaaggaagaaatcctccagccaccagagcctcacccg
gtgccgcccatcctgacaccgtcgcctccttcagcattcccaaccgttaccactgtgtgg
caagacagtgacaggtaccacccaaagccagtgctgcacatggcttccccagagcagccc
ccaacggacctcaacagaaactatgataagtcagcggacctaatggggagaagcgaatct
gctgttgagcacacagataaaaagttagaacaaaatttaagttttgagattaagaaagtc
cctctccaagaagggcccaaaagttttgatgggaacacactcttgaataggggacatgcg
attaaaattaagtctgcttcatcttctgtagttgacaaaagctctaagccacaggagtta
agttcaggtgatctaaaggttcacgatgtgtctcagaattcctgtgcggactgcagtgcc
tcacacttagacaacgctcctgagtcttcagaagagtcccagaactcacacacacctcca
cggccagactgcttgccccttgataagaaaggacatgtgacatggtcacttcatggacct
gaaaatgccacacctgtatctgactcaccagataatcattctcaaactctaaaaactgtg
agttccacaccaaactcgacagcagaagaggaatcccacgatctcacagagcaccataac
agctcccctctgccgagagctcctctcagctttaccaaccctcttcactctgacgactcc
gactcagacgaagggaactccgatggtgctgtgaccaagaacaaaactagcatttcaaca
gcaagtgccaccgtgtctcctgccagtagtaccgagagtgcttgcactaggagagtactg
cccatgtccattgccaggcaggaaatggcaggaaggcggcattcaggtgctgagaaagat
gctgacgttagtgaagagtcgcctcctcccttacctgaaagaactcccgagtcttttgta
ttagcagatatgcccataagatctgattggcatgaacttccaagtcaggagtgctcggag
cacagggaatctgaaggcttgataacctctggaaatgacaaacacgatgcaggggtttcc
cacacagcggcttgttcacccactttcagtgacaagaaagaggaaataacagaaagtcta
acagaagtcacagacattggttttggtaatcgctgtggaaaacctaaaggaccaagagat
ccaccttcagaatggacatga

DBGET integrated database retrieval system