KEGG   Rattus norvegicus (rat): 117261
Entry
117261            CDS       T01003                                 

Gene name
Slc15a1
Definition
(RefSeq) solute carrier family 15 member 1 isoform PepT1
  KO
K14206  solute carrier family 15 (oligopeptide transporter), member 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    117261 (Slc15a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    117261 (Slc15a1)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC15: Proton oligopeptide cotransporter
   117261 (Slc15a1)
SSDB
Motif
Pfam: PTR2 MFS_2 AlgF
Other DBs
NCBI-GeneID: 117261
NCBI-ProteinID: NP_476462
RGD: 621736
Ensembl: ENSRNOG00000011598
UniProt: P51574
Position
15
AA seq 710 aa
MGMSKSRGCFGYPLSIFFIVVNEFCERFSYYGMRALLVLYFRNFLGWDDDLSTAIYHTFV
ALCYLTPILGALIADSWLGKFKTIVSLSIVYTIGQAVISVSSINDLTDHDHDGSPNNLPL
HVALSMIGLALIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIFYLAINAGSLLSTII
TPILRVQQCGIHSQQACYPLAFGVPAALMAVALIVFVLGSGMYKKFQPQGNIMGKVAKCI
GFAIKNRFRHRSKAFPKREHWLDWAKEKYDERLISQIKMVTKVMFLYIPLPMFWALFDQQ
GSRWTLQATTMTGKIGTIEIQPDQMQTVNAILIVIMVPIVDAVVYPLIAKCGFNFTSLKK
MTVGMFLASMAFVVAAIVQVEIDKTLPVFPSGNQVQIKVLNIGNNDMAVYFPGKNVTVAQ
MSQTDTFMTFDVDQLTSINVSSPGSPGVTTVAHEFEPGHRHTLLVWGPNLYRVVKDGLNQ
KPEKGENGIRFVSTLNEMITIKMSGKVYENVTSHSASNYQFFPSGQKDYTINTTEIAPNC
SSDFKSSNLDFGSAYTYVIRSRASDGCLEVKEFEDIPPNTVNMALQIPQYFLLTCGEVVF
SVTGLEFSYSQAPSNMKSVLQAGWLLTVAIGNIIVLIVAEAGHFDKQWAEYVLFASLLLV
VCIIFAIMARFYTYINPAEIEAQFDEDEKKKGVGKENPYSSLEPVSQTNM
NT seq 2133 nt   +upstreamnt  +downstreamnt
atggggatgtccaagtctcggggttgctttggctacccattgagcatcttcttcatcgtg
gtcaatgaattctgtgaaagattctcctactatgggatgcgagctctcctggttctgtac
ttcaggaacttccttggctgggatgatgacctctccacggccatctaccatacgtttgtt
gccctctgctacctgacgccaattcttggagctctgatcgcagactcgtggctggggaag
ttcaagacaattgtctcactatccatcgtctacacgatcggacaggccgtcatctcagtg
agctcaattaatgaccttacagaccatgaccacgacggcagtcctaacaaccttcctttg
cacgtagcactgtccatgatcggcctggccctgatagcccttggtacaggaggaatcaag
ccctgtgtgtctgcatttggtggcgatcagtttgaagagggtcaggaaaaacagcgaaac
cggttcttttccatcttttatttggctatcaacgcaggaagcctgctctccacgatcatc
actcccatactcagagttcagcagtgcggaatccacagccaacaagcttgttacccactg
gcctttggggttccggcagctctcatggctgttgccctaattgtgtttgtcctcggcagt
ggaatgtacaagaagtttcagccccagggcaacatcatgggcaaagtggccaagtgcatt
ggctttgccatcaaaaacaggtttcggcaccgaagtaaggcatttcccaagagggaacac
tggctggactgggctaaagagaaatacgatgagaggctcatctcgcagattaagatggtg
acgaaggtgatgttcctgtacattcccctccccatgttttgggccttgtttgaccagcag
ggttccaggtggacactgcaagcaacgaccatgactgggaaaattggaacaattgagatt
cagccggaccagatgcagacggtgaacgccatcttgattgtcatcatggtccccattgtg
gacgccgtggtgtatccgctcattgcaaaatgtggtttcaacttcacctccctgaagaag
atgaccgttgggatgttcctggcatccatggcctttgtggtggctgcaattgtgcaggtg
gaaatcgataaaactcttccagtcttccccagcggaaatcaagttcaaattaaggtcttg
aacattggaaacaatgacatggccgtgtattttcctggaaagaatgtgacagttgcccaa
atgtctcagacagacacattcatgactttcgatgtagaccagctgacaagcataaacgtg
tcttctcccggatctccaggcgtcaccacggtagctcatgagtttgagccgggtcaccgg
cacacccttctagtgtggggccccaatctataccgtgtggtaaaagacggtcttaaccaa
aagccagagaaaggggagaacggaatcagattcgtcagcacccttaacgagatgatcacc
atcaaaatgagtggaaaagtgtacgaaaatgtcaccagtcacagcgccagcaactaccag
tttttcccttctggccaaaaagactacacaataaacaccacagagattgcaccaaactgt
tcatctgattttaaatcttccaaccttgacttcggcagcgcgtacacctacgtgatcaga
agtagggcgagtgatggctgcctggaagtgaaggaattcgaagacatcccacccaacacg
gtgaacatggccctgcagatcccacagtacttcctcctcacctgcggcgaggtggtcttc
tctgtcacaggactggagttctcctattcccaggccccgtctaacatgaagtccgtgctt
caggcaggatggcttctaaccgtggccatcggtaatatcattgtcctcattgtggctgag
gcaggccacttcgacaaacagtgggctgagtatgttctgttcgcctccttgctcctggtc
gtctgcatcatatttgccattatggcccgattctacacctacatcaacccagcagagatc
gaggcacagttcgatgaggatgagaagaaaaagggcgtagggaaggaaaacccgtattcc
tcgttggaacctgtctcacagacaaacatgtga

DBGET integrated database retrieval system