KEGG   Rattus norvegicus (rat): 117262Help
Entry
117262            CDS       T01003                                 

Gene name
Psmc4, Tbp7
Definition
(RefSeq) proteasome 26S subunit, ATPase 4
  KO
K03063  26S proteasome regulatory subunit T3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    117262 (Psmc4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    117262 (Psmc4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    117262 (Psmc4)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     117262 (Psmc4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA Prot_ATP_ID_OB AAA_lid_3 AAA_2 AAA_5 AAA_16 RuvB_N DUF815 AAA_22 RNA_helicase NTPase_1 Mg_chelatase AAA_14 AAA_28 AAA_18 IstB_IS21 AAA_33 Sigma54_activat NACHT TIP49 CENP-F_leu_zip AAA_3 TsaE ATPase_2 AAA_7 AAA_24 AAA_25 DUF3450 Zeta_toxin NB-ARC Parvo_NS1 AAA_17 ABC_tran DivIVA AAA_30
Motif
Other DBs
NCBI-GeneID: 117262
NCBI-ProteinID: NP_476463
RGD: 621102
Ensembl: ENSRNOG00000018994
UniProt: Q63570
Structure
PDB: 

Position
1q21
AA seq 418 aa AA seqDB search
MEEIGILVEKIQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEY
IKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTID
RELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREA
VELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYL
GEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFD
QNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDL
EDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggaggagataggcattttggtggagaaaattcaggatgagatcccagcactgtccgtg
tctcggccgcagaccggcctgtcctttctgggacccgaacctgaggacctggaggaccta
tacagccgctacaagaagctacagcaagagctggagttcctggaggtgcaggaggagtat
atcaaggatgagcagaagaacctgaagaaggagttcctccatgcgcaggaggaggtaaag
cgaatccagagcattccgttggtcattggtcagtttttggaagctgtggatcagaacaca
gccattgtgggctctaccacaggctctaactactatgtgcgcatcctgagtaccattgat
cgggagctgctcaaacccaatgcctcagtggccctgcacaagcacagcaacgcactggtg
gatgtgctgcctcccgaggccgacagcagcatcatgatgctcacctcagaccagaagccc
gacgtgatgtacgccgatattggaggcatggacatccagaagcaggaggtgcgggaggct
gtggaactaccactgacgcacttcgagctctacaagcagattggcatcgatcctccccga
ggtgtcctcatgtatggcccacctggctgtggaaagaccatgttagcgaaggctgtggca
catcacacgacagctgcatttatccgtgtggtgggctcagagtttgttcagaagtacctg
ggtgagggcccccgaatggtccgggatgtgttccgcctggccaaggagaatgcacctgcc
atcatcttcatagatgaaattgatgccattgccaccaagagattcgatgcccagacagga
gctgacagggaggttcagaggatcctgctggagctactgaatcaaatggatggatttgac
caaaacgtcaatgtgaaggtaatcatggccacaaacagagcagacaccttggatccagct
ctacttcggccaggacgcctggaccgcaaaattgaattcccactccctgatcgtcgccag
aagaggttgattttctccaccatcaccagcaagatgaacctttctgaggaggtcgaccta
gaagactatgtggcccgcccagataagatttcaggagccgatatcaactccatctgtcag
gagagtggaatgttggctgtccgtgagaaccgctacattgtcctggccaaggacttcgag
aaagcatacaagaccgtgatcaagaaagatgagcaggaacatgagttttacaagtga

DBGET integrated database retrieval system