KEGG   Rattus norvegicus (rat): 117262
Entry
117262            CDS       T01003                                 

Gene name
Psmc4
Definition
(RefSeq) 26S proteasome regulatory subunit 6B
  KO
K03063  26S proteasome regulatory subunit T3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    117262 (Psmc4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    117262 (Psmc4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    117262 (Psmc4)
   05012 Parkinson disease
    117262 (Psmc4)
   05014 Amyotrophic lateral sclerosis
    117262 (Psmc4)
   05016 Huntington disease
    117262 (Psmc4)
   05017 Spinocerebellar ataxia
    117262 (Psmc4)
   05020 Prion disease
    117262 (Psmc4)
   05022 Pathways of neurodegeneration - multiple diseases
    117262 (Psmc4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    117262 (Psmc4)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     117262 (Psmc4)
SSDB
Motif
Pfam: AAA Prot_ATP_ID_OB AAA_lid_3 AAA_2 AAA_5 AAA_16 RuvB_N DUF815 AAA_22 RNA_helicase AAA_14 Mg_chelatase AAA_28 NTPase_1 AAA_18 AAA_33 Sigma54_activat NACHT TIP49 CENP-F_leu_zip AAA_3 IstB_IS21 ATPase_2 Zeta_toxin AAA_7 TsaE AAA_24 AAA_17 AAA_25 NB-ARC Parvo_NS1 DUF3450 ABC_tran AAA_30
Other DBs
NCBI-GeneID: 117262
NCBI-ProteinID: NP_476463
RGD: 621102
Ensembl: ENSRNOG00000018994
UniProt: Q63570
Structure
PDB: 
2DWZ 6EPF 6EPC 6EPE 6EPD

Position
1
AA seq 418 aa
MEEIGILVEKIQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEY
IKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTID
RELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREA
VELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYL
GEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFD
QNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDL
EDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggaggagataggcattttggtggagaaaattcaggatgagatcccagcactgtccgtg
tctcggccgcagaccggcctgtcctttctgggacccgaacctgaggacctggaggaccta
tacagccgctacaagaagctacagcaagagctggagttcctggaggtgcaggaggagtat
atcaaggatgagcagaagaacctgaagaaggagttcctccatgcgcaggaggaggtaaag
cgaatccagagcattccgttggtcattggtcagtttttggaagctgtggatcagaacaca
gccattgtgggctctaccacaggctctaactactatgtgcgcatcctgagtaccattgat
cgggagctgctcaaacccaatgcctcagtggccctgcacaagcacagcaacgcactggtg
gatgtgctgcctcccgaggccgacagcagcatcatgatgctcacctcagaccagaagccc
gacgtgatgtacgccgatattggaggcatggacatccagaagcaggaggtgcgggaggct
gtggaactaccactgacgcacttcgagctctacaagcagattggcatcgatcctccccga
ggtgtcctcatgtatggcccacctggctgtggaaagaccatgttagcgaaggctgtggca
catcacacgacagctgcatttatccgtgtggtgggctcagagtttgttcagaagtacctg
ggtgagggcccccgaatggtccgggatgtgttccgcctggccaaggagaatgcacctgcc
atcatcttcatagatgaaattgatgccattgccaccaagagattcgatgcccagacagga
gctgacagggaggttcagaggatcctgctggagctactgaatcaaatggatggatttgac
caaaacgtcaatgtgaaggtaatcatggccacaaacagagcagacaccttggatccagct
ctacttcggccaggacgcctggaccgcaaaattgaattcccactccctgatcgtcgccag
aagaggttgattttctccaccatcaccagcaagatgaacctttctgaggaggtcgaccta
gaagactatgtggcccgcccagataagatttcaggagccgatatcaactccatctgtcag
gagagtggaatgttggctgtccgtgagaaccgctacattgtcctggccaaggacttcgag
aaagcatacaagaccgtgatcaagaaagatgagcaggaacatgagttttacaagtga

KEGG   Rattus norvegicus (rat): 117263
Entry
117263            CDS       T01003                                 

Gene name
Psmc1
Definition
(RefSeq) 26S proteasome regulatory subunit 4
  KO
K03062  26S proteasome regulatory subunit T2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05169  Epstein-Barr virus infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    117263 (Psmc1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    117263 (Psmc1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    117263 (Psmc1)
   05165 Human papillomavirus infection
    117263 (Psmc1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    117263 (Psmc1)
   05012 Parkinson disease
    117263 (Psmc1)
   05014 Amyotrophic lateral sclerosis
    117263 (Psmc1)
   05016 Huntington disease
    117263 (Psmc1)
   05017 Spinocerebellar ataxia
    117263 (Psmc1)
   05020 Prion disease
    117263 (Psmc1)
   05022 Pathways of neurodegeneration - multiple diseases
    117263 (Psmc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    117263 (Psmc1)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     117263 (Psmc1)
SSDB
Motif
Pfam: AAA AAA_lid_3 Prot_ATP_ID_OB AAA_2 AAA_22 DUF815 RuvB_N AAA_5 AAA_16 AAA_18 AAA_25 AAA_33 ATPase IstB_IS21 AAA_28 AAA_3 RNA_helicase AAA_14 Mg_chelatase TIP49 AAA_7 Prot_ATP_OB_N NACHT PhoH AAA_24 AAA_30 NB-ARC ABC_tran Parvo_NS1 TsaE Sigma54_activat
Other DBs
NCBI-GeneID: 117263
NCBI-ProteinID: NP_476464
RGD: 621097
Ensembl: ENSRNOG00000003951
UniProt: P62193
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
6
AA seq 440 aa
MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQCRL
KLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNH
AIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAP
QETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVA
NQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSG
GEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKT
KKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFK
KSKENVLYKKQEGTPEGLYL
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgggtcaaagtcagagtggtggccatggtcctgggggtggcaagaaggatgacaaggac
aagaaaaagaaatatgaacctcctgtcccaactagagtggggaaaaagaagaagaaaacc
aagggaccagatgctgccagcaaactgccactggtaacacctcacacccagtgccgcctg
aaattactaaagctggagagaataaaagactatcttctcatggaggaagaattcattaga
aatcaggaacagatgaaaccactagaagaaaagcaagaggaggaaagatcaaaggtggat
gatcttaggggaacccccatgtctgtaggaaccttggaagagatcatcgatgataatcac
gccattgtgtccacatcggtgggctcagaacactacgtcagcatcctgtcatttgtagac
aaggatctgctggaaccgggctgttcagtcctgctcaaccacaaggtgcatgctgtgata
ggggtgctcatggatgacacggatcccctggtcacagtgatgaaggtggaaaaggccccc
caggaaacctatgcagatattgggggactggacaaccagatccaggaaattaaggaatct
gtggagctccctcttacccaccctgagtattatgaggagatggggataaaaccacctaag
ggggtcattctctacggcccgccagggacaggtaaaactctattggccaaagcagtagcg
aaccagacttcagcgactttcttgcgagtggttggctcagagcttattcagaagtaccta
ggtgacgggcccaagctggtccgggagctcttccgggtcgctgaggaacacgcaccgtcc
attgtgttcattgatgaaatcgacgccattgggaccaaaagatatgattcaaactctgga
ggtgagcgggaaatccagcggacaatgttggaactgttgaaccagttggatggatttgat
tcgaggggagatgtaaaagttatcatggccacaaaccgaatagaaactttggatccagca
cttatcagaccaggccgcattgacagaaagatcgagttccccctgcctgatgaaaagacc
aagaagcgcatcttccagatccacacaagcaggatgacgctggctgatgatgtaaccttg
gatgacttgatcatggcaaaggatgacctctctggggctgacatcaaggcaatctgcaca
gaggctggcttgatggctctgcgggaacgcaggatgaaagtgacaaacgaagacttcaag
aaatctaaggagaacgttctgtataaaaaacaagaaggcacccctgaggggctgtatctc
tag

KEGG   Rattus norvegicus (rat): 161475
Entry
161475            CDS       T01003                                 

Gene name
Psmd9
Definition
(RefSeq) 26S proteasome non-ATPase regulatory subunit 9
  KO
K06693  26S proteasome regulatory subunit N4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    161475 (Psmd9)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    161475 (Psmd9)
   05012 Parkinson disease
    161475 (Psmd9)
   05014 Amyotrophic lateral sclerosis
    161475 (Psmd9)
   05016 Huntington disease
    161475 (Psmd9)
   05017 Spinocerebellar ataxia
    161475 (Psmd9)
   05020 Prion disease
    161475 (Psmd9)
   05022 Pathways of neurodegeneration - multiple diseases
    161475 (Psmd9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    161475 (Psmd9)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     161475 (Psmd9)
SSDB
Motif
Pfam: Nas2_N PDZ_6 PDZ_2 PDZ GRASP55_65
Other DBs
NCBI-GeneID: 161475
NCBI-ProteinID: NP_569114
RGD: 621110
Ensembl: ENSRNOG00000001339
UniProt: Q9WTV5
Position
12
AA seq 222 aa
MSSEEVRHRAESSEARAAAVSDIQELMRRKEEIEAQIKANYDVLESQKGIGMNEPLVDCE
GYPRADVDLYQVRTARHNIICLQNDHKALMKQVEEALHQLHARDKEKQARDMAEAREEAM
NRRLASDSPALPKAFARVNSISPGSPASIAGLQVDDEIVEFGSVNTQNFQSLQNVGSVVQ
HSEGKPLNVMVIRRGEKHQLRLTPTRWAGKGLLGCNITPLQR
NT seq 669 nt   +upstreamnt  +downstreamnt
atgtcgagtgaggaagtccggcaccgggcagagtcctctgaggcccgtgcggccgcggtc
agcgacatccaggagctgatgcgacgcaaggaggaaatcgaggcgcagatcaaggctaat
tacgacgtcctcgagagccaaaaaggaattggcatgaacgagcctctagtggactgcgag
ggctacccccgggcagatgtggatttgtatcaggtccgaacagcaaggcacaacatcatc
tgtctccagaatgatcacaaggcactgatgaagcaggtggaggaggccctacaccagcta
catgctcgggacaaagagaagcaggctcgggacatggctgaagcccgagaagaggccatg
aaccgtaggctggcctcggacagtcccgccctacccaaggcctttgccagagtgaacagt
atcagccctggttccccagccagtattgcgggcctgcaagtggatgatgaaattgtggag
ttcggctctgtgaacacccaaaacttccagtctctgcagaacgtgggctctgtggtgcag
cacagcgaggggaagcccctgaatgtcatggtgatccgcagaggggagaagcaccagctc
agactgactcccacccgctgggcaggaaaaggactgctgggctgcaatattacccctctc
caaagatga

KEGG   Rattus norvegicus (rat): 25581
Entry
25581             CDS       T01003                                 

Gene name
Psmc2
Definition
(RefSeq) 26S proteasome regulatory subunit 7
  KO
K03061  26S proteasome regulatory subunit T1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    25581 (Psmc2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    25581 (Psmc2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    25581 (Psmc2)
   05012 Parkinson disease
    25581 (Psmc2)
   05014 Amyotrophic lateral sclerosis
    25581 (Psmc2)
   05016 Huntington disease
    25581 (Psmc2)
   05017 Spinocerebellar ataxia
    25581 (Psmc2)
   05020 Prion disease
    25581 (Psmc2)
   05022 Pathways of neurodegeneration - multiple diseases
    25581 (Psmc2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    25581 (Psmc2)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     25581 (Psmc2)
SSDB
Motif
Pfam: AAA AAA_lid_3 AAA_22 AAA_5 AAA_16 AAA_28 AAA_7 AAA_2 AAA_18 RuvB_N Sigma54_activ_2 DUF815 AAA_33 Mg_chelatase TIP49 AAA_24 AAA_14 HMW1C_N IstB_IS21
Other DBs
NCBI-GeneID: 25581
NCBI-ProteinID: NP_150239
RGD: 3428
Ensembl: ENSRNOG00000012026
UniProt: Q63347
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
4
AA seq 433 aa
MPDYLGADQRKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKIN
ELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAK
FVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGC
KEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIPV
IGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTML
ELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHAR
SMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIKSY
AKFSATPRYMTYN
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgccggattacctaggtgcagaccagcggaaaaccaaagaggatgagaaggacgacaag
cccatccgagctctggatgaaggggatatcgccttgttgaaaacttatggccagagtact
tattcgaggcagatcaagcaggttgaagatgacattcagcaacttcttaaaaaaattaat
gagctcactggtatcaaagagtccgacactgggctggcccctccagccctctgggatttg
gctgcagacaaacagacacttcagagtgaacagccgctacaggttgcaagatgtaccaag
ataatcaacgccgattcagaggacccgaaatacatcatcaacgtgaagcagtttgccaag
ttcgtggtggatctcagtgatcaggtggcacctactgacattgaggaagggatgagagtc
ggcgtggacagaaataaataccaaattcacattccactgcctcctaagattgacccaaca
gttaccatgatgcaggtggaggaaaaacctgatgtcacatacagtgacgttggtggctgt
aaggaacagattgagaaattgcgggaagtggttgaaacccctctactccatccagagagg
tttgttaaccttggaatcgagcctccgaagggtgtgttgttatttgggccaccaggcaca
ggcaagaccctctgtgccagggcagtggccaatcggactgatgcttgcttcatcccagtt
atcgggtctgagcttgtacagaagtacgtcggtgagggggctcgaatggttcgggagctt
tttgaaatggccaggacaaaaaaagcctgccttattttctttgatgaaattgatgccatt
ggaggggctcggtttgacgatggcgctgggggtgacaatgaggtgcagaggaccatgttg
gagctcatcaatcagctggatggctttgatcctcggggcaacatcaaagtgctcatggcc
actaaccgacctgatactctggacccagcgctgatgaggccagggaggctggacagaaag
attgagttcagcttacctgacttagagggtcgaacgcacatctttaagattcatgctcgc
tcaatgagtgtggaaagagacatccgatttgagctactagcccgcctgtgtccaaacagt
actggagcggagattagaagcgtttgcacagaggctggtatgtttgcaatccgagcccgg
agaaagattgctacagagaaggacttcttagaagctgtaaataaggtcatcaagtcgtat
gccaaatttagtgctactccccgctacatgacatacaactga

KEGG   Rattus norvegicus (rat): 287670
Entry
287670            CDS       T01003                                 

Gene name
Psmd3
Definition
(RefSeq) 26S proteasome non-ATPase regulatory subunit 3
  KO
K03033  26S proteasome regulatory subunit N3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    287670 (Psmd3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    287670 (Psmd3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    287670 (Psmd3)
   05012 Parkinson disease
    287670 (Psmd3)
   05014 Amyotrophic lateral sclerosis
    287670 (Psmd3)
   05016 Huntington disease
    287670 (Psmd3)
   05017 Spinocerebellar ataxia
    287670 (Psmd3)
   05020 Prion disease
    287670 (Psmd3)
   05022 Pathways of neurodegeneration - multiple diseases
    287670 (Psmd3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    287670 (Psmd3)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     287670 (Psmd3)
SSDB
Motif
Pfam: Rpn3_C PCI CSN8_PSD8_EIF3K TPR_2
Other DBs
NCBI-GeneID: 287670
NCBI-ProteinID: NP_001008282
RGD: 1311470
Ensembl: ENSRNOG00000028103
UniProt: Q5U2S7
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
10
AA seq 530 aa
MKQEGSARRRGADKAKPPPGGEQEPPPPAPQDVEMKEEAAAGSGSAGEGDGKAAATEHSQ
RELDTVTLEDIKEHVRQLEKAVSGKEPRFVLRALRMLPSTSRRLNHYVLYKAVHGFFTSN
NATRDFLLPFLEEPMDTEADLQFRPRTGKAASAPLLPEVEAYLQLLMVIFLMNSKRYKEA
QKISDDLMQKISTQNRRALDLVAAKCYYYHARVYEFLDKLDVVRSFLHARLRTATLRHDA
DGQATLLNLLLRNYLHYSLYDQAEKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSE
ARRTMTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLT
QAVRTGNLAKFNQVLDQFGEKFQTDGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQ
KLQLDSPEDAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCL
DIHNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSFP
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgaagcaggagggctcggcgcggcgccgaggcgccgacaaggcaaagccgccgccggga
ggggaacaagaaccgccgccgccggccccccaggatgtggagatgaaagaggaggcagca
gctgggagcggctccgcgggggaaggagacggcaaggcagctgcgaccgagcactcccag
cgagagttggacactgtcaccttagaagacatcaaagagcatgtgagacagctagagaag
gctgtttccggcaaggagcctcggttcgtgctgagggcactgcggatgctgccatccacg
tcacgacgcctcaaccactatgttctgtataaggccgtgcatggcttcttcacctccaat
aacgccactcgagatttcttgctacccttcctagaagaacccatggacacagaggccgac
ctacagttccgtcctcgcacaggaaaagctgcgtcggcgcccctcctgcctgaggtggaa
gcctatctccagctgctcatggtcatcttcctgatgaacagcaagcgctacaaagaggca
cagaaaatctctgacgacctgatgcagaagatcagcactcagaaccgccgagccctggac
ctcgtagctgcaaagtgttactattaccacgcccgggtctacgagttcctggacaagctg
gatgtggtgcgcagcttcttgcatgcccggctccggacagccaccctccggcacgatgct
gacggacaggctacccttttgaaccttttgcttcggaattacctacattacagcttgtat
gaccaggctgagaagctagtgtccaagtctgtgttccccgaacaggctaacaacaatgag
tgggccaggtacctctactacacagggcgaatcaaggctatccaactggagtactctgaa
gcccggagaacgatgaccaatgcccttcgaaaggcaccacagcacacagcagttggcttc
aaacagacggtgcacaagcttctgattgtggtggagctgctgctgggggagatcccagac
cgcctgcagttccgtcagccctccctaaagcgctctctcatgccctacttccttctcacc
caagctgttaggacaggaaatcttgccaagttcaaccaagtcctggatcagtttggggag
aagtttcaaacagatgggacctacaccctaattatccgactgcgacacaatgtgattaag
acaggtgtgcgtatgatcagcctgtcctattcccgtatctccctggcggacatcgcccag
aagctgcagctggacagcccagaagatgcagagttcattgtcgccaaggctatccgggat
ggtgtgattgaggccagcatcaatcatgagaagggatacgtccaatccaaagagatgatt
gacatctactccacccgggaacctcagctggctttccaccagcgcatctccttctgcctg
gacatccacaacatgtccgtcaaggccatgcgctttccccccaaatcctacaacaaggac
ctggagtctgcagaggaacggcgtgagcgggagcagcaggacttggagtttgccaaggag
atggcggaggatgacgacgacagcttcccttga

KEGG   Rattus norvegicus (rat): 287772
Entry
287772            CDS       T01003                                 

Gene name
Psmd12
Definition
(RefSeq) 26S proteasome non-ATPase regulatory subunit 12
  KO
K03035  26S proteasome regulatory subunit N5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    287772 (Psmd12)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    287772 (Psmd12)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    287772 (Psmd12)
   05012 Parkinson disease
    287772 (Psmd12)
   05014 Amyotrophic lateral sclerosis
    287772 (Psmd12)
   05016 Huntington disease
    287772 (Psmd12)
   05017 Spinocerebellar ataxia
    287772 (Psmd12)
   05020 Prion disease
    287772 (Psmd12)
   05022 Pathways of neurodegeneration - multiple diseases
    287772 (Psmd12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    287772 (Psmd12)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     287772 (Psmd12)
SSDB
Motif
Pfam: PCI RPN5_C SIX1_SD
Other DBs
NCBI-GeneID: 287772
NCBI-ProteinID: NP_001005875
RGD: 1359305
Ensembl: ENSRNOG00000003117
UniProt: Q5XIC6
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
10
AA seq 456 aa
MADGGSERADGRIVKMEVDYSATVDQRLPECEKLAKEGRLQEVIETLLSLEKQTRTASDM
VSTSRILVAVVKMCYEAKEWDLLNENIMLLSKRRSQLKQAVAKMVQQCCTYVEEITDLPV
KLRLIDTLRMVTEGKIYVEIERARLTKTLATIKEQNGDVKEAASILQELQVETYGSMEKK
ERVEFILEQMRLCLAVKDYIRTQIISKKINTKFFQEENTEKLKLKYYNLMIQLDQHEGSY
LSICKHYRAIYDTPCIQAESDKWQQALKSVVLYVILAPFDNEQSDLVHRISSDKKLEEIP
KYKDLLKLFTTMELMRWSTLVEDYGVELRKGSSETPATDVFSSTEEGEKRWKDLKNRVVE
HNIRIMAKYYTRITMKRMAQLLDLSVDESEAFLSNLVVNKTIFAKVDRLAGVINFQRPKD
PNNLLNDWSQKLNSLMSLVNKTTHLIAKEEMIHNLQ
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggcggacggcggctcggaacgggccgatgggcgcattgtgaagatggaggtggactac
agcgccacagtggaccagcgcctgcctgagtgcgagaagctggccaaggaaggacggctt
caggaagtcatcgaaacccttctctctctagaaaagcagacccggactgcctctgacatg
gtgtccacgtcccgcatcttggttgcagtagtgaaaatgtgctatgaggccaaagagtgg
gacttacttaatgaaaatattatgcttctgtcaaaacgaaggagtcagttaaaacaagca
gttgcaaaaatggtccagcagtgctgtacttatgtggaggagatcacagacctgccagtc
aagctgcggttgattgataccctgcgtatggttacagaaggaaagatttatgttgaaatt
gagcgtgccaggctgactaaaaccttagcaactataaaagagcaaaatggcgacgtgaag
gaggccgcctccatcctgcaggagttacaggtggaaacctatgggtctatggagaagaag
gagcgagtggagtttattctggagcagatgaggctctgcctagccgtgaaggattacatt
cgcacacagatcatcagcaaaaaaattaacaccaaattcttccaggaagaaaacacagag
aaattaaagttgaagtactataacttaatgattcagctggatcagcatgaggggtcctat
ctgtccatctgtaagcactacagagccatctacgacactccctgcattcaggcagaaagt
gacaagtggcagcaggctctgaagagtgttgttctctatgttatcctggctccttttgac
aatgagcagtcagatttggttcaccggataagtagtgacaagaagctggaagagattccc
aaatacaaggatctgctgaagctttttaccacaatggagctgatgcgctggtccacactt
gttgaggactatggggtggagctacggaagggctcctcggagaccccagcaactgacgtc
ttcagttctacagaagaaggtgaaaaacggtggaaagacttgaagaacagagtcgtggag
cataacatcagaattatggccaagtactacactcggataaccatgaaaaggatggcacaa
cttctggatctctctgtagatgagtcagaggccttcctctcgaatctagtcgttaacaag
accatctttgctaaagtggacaggttggctggggtcatcaacttccagagacccaaggat
ccaaataacttattaaatgactggtctcagaaactgaattcactgatgtctctggtgaac
aaaacgacacacctcatagccaaagaggagatgatacataatctacagtga

KEGG   Rattus norvegicus (rat): 287984
Entry
287984            CDS       T01003                                 

Gene name
Psmd2
Definition
(RefSeq) 26S proteasome non-ATPase regulatory subunit 2
  KO
K03028  26S proteasome regulatory subunit N1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    287984 (Psmd2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    287984 (Psmd2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    287984 (Psmd2)
   05012 Parkinson disease
    287984 (Psmd2)
   05014 Amyotrophic lateral sclerosis
    287984 (Psmd2)
   05016 Huntington disease
    287984 (Psmd2)
   05017 Spinocerebellar ataxia
    287984 (Psmd2)
   05020 Prion disease
    287984 (Psmd2)
   05022 Pathways of neurodegeneration - multiple diseases
    287984 (Psmd2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    287984 (Psmd2)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     287984 (Psmd2)
SSDB
Motif
Pfam: RPN1_RPN2_N RPN1_C PC_rep THAP
Other DBs
NCBI-GeneID: 287984
NCBI-ProteinID: NP_001026809
RGD: 1305752
Ensembl: ENSRNOG00000001719
UniProt: Q4FZT9
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
11
AA seq 908 aa
MEEGGRDKTPVQSQQPSATAPSGADEKSSGKERRDAGEKDKEQELSEEDKQLQDELEMLV
ERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLKEIYENMAPGENKC
FAADIISVLAMTMSGERECLKYRLVGSQEELASWGHEYVRHLAGEVAKEWQELDDAEKAQ
REPLLTLVKEIVPYNMAHNAEHEACDLLMEIEQVDMLEKDIDENAYSKVCLYLTSCVNYV
PEPENSALLRCALGVFRKFSRFPEALRLALMLNDMELVEDIFTSCKDVVVQKQMAFMLGR
HGVFLELSEDVEEYEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGG
SGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDDGNKWLYKNKDHGMLSAAASLGMILLW
DVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYVLHNSNTMRLG
SIFGLGLAYAGSNREDVLTLLLPVMGDSKSSMEVAGVTALACGMIAVGSCNGDVTSTILQ
TIMEKSETELKDTYARWLPLGLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAY
AGSGNVLKVQQLLHICSEHFDSKEKEEDKDKKEKKDKDKKEAPADMGAHQGVAVLGIALI
AMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPE
VSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCP
YHSDRQLMSQVAVAGLLTVLVSFLDVRNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPL
PVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEFLPVTPILEGFVIL
RKNPNYNL
NT seq 2727 nt   +upstreamnt  +downstreamnt
atggaggagggtggacgagacaagacacccgtgcagtcccaacaaccctcagcgacagcc
cccagcggcgcggacgagaagtcgagcggcaaggagcgacgggatgccggggaaaaagat
aaagagcaggagctgtctgaggaggacaaacagcttcaagatgaactggagatgctcgtg
gagcgactcggggaaaaggatacatccctgtaccgaccagctctggaggaactgagaaga
caaatccgttcttctacaacttccatgacctcagtaccgaaacctctcaaatttctgcgt
ccacactatggcaaactgaaggaaatctatgagaacatggcccctggggagaataagtgc
tttgctgctgacatcatctctgttttggccatgaccatgagtggtgagcgggagtgcctc
aagtatcggctagtgggctcccaggaagaattggcatcgtggggtcatgagtatgtcaga
catctggcaggagaagtggctaaggagtggcaggaactggatgatgcagagaaagcacag
cgggaaccattgcttaccttggtaaaggaaatcgtcccctacaacatggctcacaatgct
gagcacgaggcttgtgacctgctcatggagatcgagcaggtggatatgctggagaaggac
atcgatgagaatgcatactccaaggtctgcctctatctcaccagttgtgtgaattatgta
ccagaacctgagaactctgccctcctgcgctgtgccctgggcgtgttccgaaagtttagc
cgtttccctgaagctctgagattggcactgatgctcaatgacatggaactggtagaagac
attttcacctcctgcaaggatgtggtggtccagaagcagatggccttcatgctgggtcgg
catggagtgttcctggagctgagtgaagatgtagaggaatacgaagacctcacagaaatc
atgtccaatgtccagctcaacagcaacttcttggccttagctcgggagctggacatcatg
gagcccaaggtgcctgatgacatctacaaaacccacctagagaataacaggtttggtggc
agtggctctcaggtagattctgctcgaatgaacctagcgtcctcttttgtgaatggcttt
gtgaacgcagcctttggtcaggataaactcctgaccgacgatggcaacaaatggctgtac
aagaacaaggaccacgggatgttaagtgctgctgcgtcccttggcatgattctgctgtgg
gatgtggatggtggcctcacccagattgacaagtatctgtactcctctgaggactacatc
aagtcaggagctctccttgcctgtggtatcgtgaattctggggttcggaatgagtgcgat
cctgccctggcactgctttccgactacgttctccataacagcaataccatgagacttggc
tccatcttcggactaggtttggcctatgctggctctaatcgggaagatgttctaacactg
ctgctacctgtaatgggagattccaagtccagcatggaggtcgcaggtgtgacggctctg
gcttgtgggatgatagcagtggggtcttgcaatggagatgtcacttcgaccattcttcag
accatcatggagaaatctgagactgagctcaaggacacctacgctcgttggcttcctctt
ggcctgggcctcaatcacttggggaagggcgaagccatcgaggcgatcctggctgccctg
gaggttgtgtcagaaccgttccgcagctttgccaacactctggtggatgtgtgtgcctat
gcaggttccgggaacgtgctgaaggttcagcagctcctccacatctgcagtgagcacttc
gactctaaggagaaggaagaagacaaggacaagaaggaaaagaaggacaaggacaagaag
gaggcccctgccgacatgggagcacatcagggagtagctgttctgggaatcgcacttatt
gctatgggggaagagattggtgcagagatggcattgcgaacttttggtcatttgctgaga
tatggggaacctaccctccgtcgggctgtaccgttagcactggcactaatctctgtttca
aatccacgactcaacatcctggataccctaagcaaattctctcatgatgctgatccagaa
gtttcttataactccatctttgctatgggcatggtgggcagtggtaccaacaatgcccgt
ctggctgcaatgctgcgccagttagctcagtatcacgccaaggaccccaataacctcttc
atggtgcgcttggcacagggcctgacacatttagggaagggcacacttaccctctgcccc
taccacagtgaccggcagctcatgagtcaagtggctgtggcggggctgctcaccgtgctt
gtttctttcctggatgtgcgaaacatcattctagggaaatctcactatgtactgtatggg
ctggtggccgccatgcagcctcggatgctggttacatttgatgaggagttgcgaccattg
ccagtttctgtccgcgtgggtcaggcagtggatgtggtgggccaggctgggaagcccaaa
acgatcacggggttccagactcacacaactccagtgctgttggcccatggggaacgggcg
gagctggccactgaggagtttctccctgtcaccccaattctggaaggctttgtcattctt
cgaaagaaccccaactacaatctttga

KEGG   Rattus norvegicus (rat): 289924
Entry
289924            CDS       T01003                                 

Gene name
Psmd6
Definition
(RefSeq) 26S proteasome non-ATPase regulatory subunit 6
  KO
K03037  26S proteasome regulatory subunit N7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    289924 (Psmd6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    289924 (Psmd6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    289924 (Psmd6)
   05012 Parkinson disease
    289924 (Psmd6)
   05014 Amyotrophic lateral sclerosis
    289924 (Psmd6)
   05016 Huntington disease
    289924 (Psmd6)
   05017 Spinocerebellar ataxia
    289924 (Psmd6)
   05020 Prion disease
    289924 (Psmd6)
   05022 Pathways of neurodegeneration - multiple diseases
    289924 (Psmd6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    289924 (Psmd6)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     289924 (Psmd6)
SSDB
Motif
Pfam: RPN7 PCI LigB
Other DBs
NCBI-GeneID: 289924
NCBI-ProteinID: NP_942025
RGD: 735127
Ensembl: ENSRNOG00000006751
UniProt: Q6PCT9
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
15
AA seq 389 aa
MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDTAVREELMAAVRENNMAPYYEALCKS
LDWQMDMDLLSKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCQIGDKEGA
LTAFRKTYDKTVALGHRLDIVFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRL
KVYQGLYCVAIRDFKQAAELFLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKV
IKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAVVEQEMKKDWLFAPHYRYYVREMR
IHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPD
SKNWQYQETIKKGDLLLNRVQKLSRVINM
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgccgctagaaaacctagaggaagagggtctgcccaagaacccggatctgcgcatcgcg
cagctgcgctttctgcttagcctgccggagcaccgcggggacacggcggtgcgcgaggag
ctgatggccgccgtccgggaaaacaatatggctccttattatgaagccttgtgtaaatcc
ctcgactggcagatggacatggatctcctcagtaaaatgaagaaagcaaacgaggaagag
ttgaaacgtctggatgaggagttggaggatgcagagaagaatctgggagaaagtgaaatt
cgagatgcaatgatggcaaaagcagagtacctctgtcagataggtgacaaggagggagct
ctgacagcctttcgcaagacatatgataagactgtggccctgggtcaccgactagatatt
gtattctatctcctaaggattggactcttttatatggataatgacctcatcactcgaaac
acagaaaaggccaaaagccttatagaggaaggcggagactgggaccggcgaaacaggctg
aaagtgtatcaaggcttgtattgtgtggctatccgtgacttcaaacaggcagcagagctc
tttcttgacaccgtttctacatttacgtcctatgagctcatggattacaagacatttgtg
acttacactgtttatgtcagtatgattgccttagaaagaccagatctcagagaaaaggtc
atcaaaggggcagagattcttgaagtgttgcacagtctcccggcagttcggcagtatctg
ttttctctctatgaatgccgttactccgttttcttccagtcgttagcggtcgtagagcag
gagatgaaaaaggactggctttttgcgcctcattaccgatactatgtgagagaaatgcgg
atccatgcatacagccagctgctggagtcatataggtcattaacccttggctatatggca
gaagcatttggtgtgggtgtggaattcatcgaccaggaactgtccaggtttattgctgct
ggaagactacactgtaaaatcgataaagtaaatgaaatagtagaaaccaacagacctgac
agcaagaattggcagtaccaagagaccatcaagaaaggagacttgctgctgaacagggtt
cagaaattatccagagtaattaacatgtaa

KEGG   Rattus norvegicus (rat): 289990
Entry
289990            CDS       T01003                                 

Gene name
Psmc6
Definition
(RefSeq) 26S protease regulatory subunit 10B
  KO
K03064  26S proteasome regulatory subunit T4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    289990 (Psmc6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    289990 (Psmc6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    289990 (Psmc6)
   05012 Parkinson disease
    289990 (Psmc6)
   05014 Amyotrophic lateral sclerosis
    289990 (Psmc6)
   05016 Huntington disease
    289990 (Psmc6)
   05017 Spinocerebellar ataxia
    289990 (Psmc6)
   05020 Prion disease
    289990 (Psmc6)
   05022 Pathways of neurodegeneration - multiple diseases
    289990 (Psmc6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    289990 (Psmc6)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     289990 (Psmc6)
SSDB
Motif
Pfam: AAA AAA_lid_3 Prot_ATP_ID_OB AAA_16 AAA_5 AAA_22 AAA_2 RuvB_N AAA_33 AAA_18 Prot_ATP_OB_N DUF815 AAA_7 AAA_14 DUF5906 AAA_3 TPR_MLP1_2 RNA_helicase TIP49 bpMoxR Mg_chelatase AAA_11 TsaE Wtap AAA_24 ATPase NACHT AAA_25 AAA_19 AAA_28 IstB_IS21 Med4 DUF4140
Other DBs
NCBI-GeneID: 289990
NCBI-ProteinID: NP_001093979
RGD: 1308825
Ensembl: ENSRNOG00000007203
UniProt: G3V6W6 Q32PW9
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
15
AA seq 403 aa
MALPGIPYERRLLIMADPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSEND
LKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLT
IMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIP
PKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQ
PCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLD
PALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNV
CTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggcccttcccggcatcccctatgagcgacggcttctcatcatggcggaccctagagat
aaggcgcttcaggactaccgcaagaagctgctagaacacaaggagattgacggccgtctt
aaggagctaagggaacaattaaaagaacttaccaagcagtatgaaaagtctgaaaatgat
ctgaaggcactacaaagtgttggacagattgtaggcgaagtgcttaaacagttaacagaa
gaaaagttcattgttaaagcaacaaacggaccaagatacgtcgtaggctgtcgtcggcag
cttgataaaagtaagctgaagccaggaaccagagttgctttggatatgaccaccctaacc
atcatgaggtatctgccgagagaggtggatccattggtttataacatgtctcatgaggat
cctggaaatgtatcttattctgagattggaggcctgtcagaacagattcgggaattaaga
gaggtaatagaattacctcttacaaatccagaattattccagcgtgtaggaataatacct
ccaaaaggctgtttgctctatggaccaccaggcactgggaaaacactcttggcacgagct
gtcgccagccagctggactgcaacttcctaaaggttgtgtcaagctctattgtagacaag
tacattggggaaagcgctcgtttgattagagaaatgtttaattatgccagggaccaccag
ccatgcatcatttttatggatgaaatagatgctattggtggtcgtcggttttctgaggga
acatcagctgacagagagattcagagaactttaatggagttactaaatcaaatggatgga
tttgacactcttcatagagttaaaatgatcatggctacaaacagaccagatacactggat
cctgctttgctgcgcccaggaagattagatagaaaaatacatattgatttaccaaatgaa
caagcaagattagatatattgaaaatccacgctggtcctattacaaagcatggtgaaata
gattatgaagccattgtaaagctttcagatggctttaatggagcagacctgagaaatgtt
tgtactgaagcaggtatgtttgcaattcgtgctgatcatgattttgtagttcaggaagac
ttcatgaaagcagtcagaaaagtggctgactccaagaagctagagtccaaactggactat
aaacctgtgtaa

KEGG   Rattus norvegicus (rat): 292766
Entry
292766            CDS       T01003                                 

Gene name
Psmd8
Definition
(RefSeq) 26S proteasome non-ATPase regulatory subunit 8
  KO
K03031  26S proteasome regulatory subunit N12
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    292766 (Psmd8)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    292766 (Psmd8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    292766 (Psmd8)
   05012 Parkinson disease
    292766 (Psmd8)
   05014 Amyotrophic lateral sclerosis
    292766 (Psmd8)
   05016 Huntington disease
    292766 (Psmd8)
   05017 Spinocerebellar ataxia
    292766 (Psmd8)
   05020 Prion disease
    292766 (Psmd8)
   05022 Pathways of neurodegeneration - multiple diseases
    292766 (Psmd8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    292766 (Psmd8)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     292766 (Psmd8)
SSDB
Motif
Pfam: CSN8_PSD8_EIF3K
Other DBs
NCBI-GeneID: 292766
NCBI-ProteinID: NP_001094301
RGD: 1309842
Ensembl: ENSRNOG00000037580
UniProt: Q3B8P5 F1LMQ3
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
1
AA seq 353 aa
MFIKGRTAKAPRGEPRRSSRRGQKLAVVAPPPALGSTSRPHFRRESIARRRCRKSGRLFA
ASRKMAAAAATVNGTTGVSSSGPAATSGGILQAAAGMYEQLKDEWNRKSPNLSKCGEELG
RLKLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILCKDIPSFERYMAQLKCYYFD
YKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLM
EGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFAEATRILFFSTPK
KMTDYAKKRGWLLGPNNYYSFASQQQKPEDSTIPSTELARQVIEYARQLEMIV
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgttcattaagggccggactgcgaaggcgcccagaggagagccgcggcgctcctcccgc
cgtgggcagaagctagcagtcgtagctccgcctccggctttgggctccacctcccggcct
cacttccgccgggagagcattgctcggcgtcgttgccgtaaatcaggtcggctgtttgct
gcatcacgaaagatggcggccgcggcggctacggtgaacgggacaaccggcgtttcaagc
tccgggcccgcggccacctcgggcgggatcctacaggcagcggccggcatgtacgagcaa
ctcaaagacgagtggaaccggaagagcccgaatcttagtaaatgtggagaagagctgggc
cgcctgaagttggttctgctggagctcaatttcctgccaaccacggggaccaaactgact
aaacagcagctcattctggcccgtgacattctggaaatcggggcccagtggagcatccta
tgcaaggacattccctccttcgagcgctacatggcccagctcaaatgctactactttgat
tacaaggagcagcttcctgagtcagcctacatgcaccagctcctgggcctcaacctcctc
ttcctgctctctcagaaccgagtggctgagttccacacagaattagaacgattgcctgcc
aaggacatccaaaccaatgtctacatcaaacaccctgtatccctcgagcaatacctcatg
gagggtagctacaacaaggtgttcctggctaagggaaacattcccgctgagagctatacc
ttcttcattgacatcctgctggatactatcagggatgaaattgcaggatgcattgagaag
gcctatgagaaaatcctttttgctgaggctacccggatcctcttcttcagcacacccaaa
aagatgacagactatgccaagaagcgaggttggctgctgggccctaacaactactacagc
tttgccagccagcagcagaagccagaagacagcaccatcccctccactgagctggccagg
caggtcatcgagtatgcccggcagctggagatgattgtctga

KEGG   Rattus norvegicus (rat): 29677
Entry
29677             CDS       T01003                                 

Gene name
Psmc3
Definition
(RefSeq) 26S proteasome regulatory subunit 6A
  KO
K03065  26S proteasome regulatory subunit T5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    29677 (Psmc3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    29677 (Psmc3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29677 (Psmc3)
   05012 Parkinson disease
    29677 (Psmc3)
   05014 Amyotrophic lateral sclerosis
    29677 (Psmc3)
   05016 Huntington disease
    29677 (Psmc3)
   05017 Spinocerebellar ataxia
    29677 (Psmc3)
   05020 Prion disease
    29677 (Psmc3)
   05022 Pathways of neurodegeneration - multiple diseases
    29677 (Psmc3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    29677 (Psmc3)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     29677 (Psmc3)
SSDB
Motif
Pfam: AAA Prot_ATP_ID_OB AAA_lid_3 AAA_5 AAA_16 RuvB_N AAA_2 AAA_22 AAA_33 Mg_chelatase AAA_11 DUF815 PhoH DUF5827 Sigma54_activat IstB_IS21 AAA_24 ATPase AAA_7 DUF3713 RNA_helicase
Other DBs
NCBI-GeneID: 29677
NCBI-ProteinID: NP_113783
RGD: 61905
Ensembl: ENSRNOG00000011414
UniProt: Q63569 Q6P6U2
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
3
AA seq 442 aa
MQEMNLLPTPESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIVQRTRLLDSEIKIMKS
EVLRVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQR
KGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEV
DERPTEQYSDIGGLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLA
RACAAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFD
SEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMP
NEEARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTH
EDYMEGILEVQAKKKANLQYYA
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgcaggaaatgaatctgctgccgacgcccgagagtccagtgactcggcaggagaagatg
gcgaccgtgtgggatgaagctgagcaagatggcattggggaggaggtgctcaagatgtcc
acagaagagatcgtccagcgcacacggctgctagacagcgagatcaagatcatgaagagt
gaagtgctgcgagtcacccacgaactccaagccatgaaagacaaaatcaaagagaacagt
gagaaaatcaaagtgaacaaaaccctcccatacctagtctccaacgttattgagttgctg
gatgttgaccccaatgaccaggaggaggatggtgccaatattgacctggactcgcagagg
aagggcaagtgtgcagtgatcaaaacttctacccgacaaacgtacttcctgccagtgatt
gggttggtagatgccgaaaagctgaagccgggagacctggtgggtgtgaacaaagactcc
tatctgatcctggagaccctgcccaccgaatatgactctcgggtgaaggccatggaggtg
gacgagcggcccacagagcaatacagtgacattggcggcctggacaagcagatccaggag
ctggtggaagccattgtcctgcctatgaaccacaaagagaagtttgagaacttgggtatc
cagcccccaaaaggagtgctgatgtatgggccgcctggtacagggaagactctcctcgcc
cgagcctgtgctgctcagaccaaggccaccttcttgaagctggcaggccctcagctggtg
cagatgtttattggagatggcgccaagctggtccgtgatgcttttgccctggccaaggag
aaggcaccatctattatctttatagatgagttggatgccattggcaccaagcgcttcgac
agtgaaaaggcaggggaccgagaggtgcagaggaccatgctagagctcctgaaccagctg
gatggcttccagcccaacacccaagtgaaggtaattgcagccactaacagggtggacatc
ctggaccctgccctgctccgctcaggacgcctagaccgcaagattgagtttccaatgccc
aatgaggaggcccgagccagaattatgcagatccactcacggaagatgaacgtcagtcct
gatgtgaactatgaagagctggctcgctgcactgatgacttcaatggggcccagtgcaag
gccgtgtgtgtggaggcgggtatgatcgcactgcgcaggggtgccacggagctcactcac
gaggactacatggagggcatcctggaggtgcaggccaagaagaaagccaacctgcagtac
tatgcctag

KEGG   Rattus norvegicus (rat): 303353
Entry
303353            CDS       T01003                                 

Gene name
Psmd11
Definition
(RefSeq) 26S proteasome non-ATPase regulatory subunit 11
  KO
K03036  26S proteasome regulatory subunit N6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    303353 (Psmd11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    303353 (Psmd11)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    303353 (Psmd11)
   05012 Parkinson disease
    303353 (Psmd11)
   05014 Amyotrophic lateral sclerosis
    303353 (Psmd11)
   05016 Huntington disease
    303353 (Psmd11)
   05017 Spinocerebellar ataxia
    303353 (Psmd11)
   05020 Prion disease
    303353 (Psmd11)
   05022 Pathways of neurodegeneration - multiple diseases
    303353 (Psmd11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    303353 (Psmd11)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     303353 (Psmd11)
SSDB
Motif
Pfam: RPN6_N PCI TPR_12 AAA_16
Other DBs
NCBI-GeneID: 303353
NCBI-ProteinID: NP_001100497
RGD: 1306450
Ensembl: ENSRNOG00000005538
UniProt: D3Z950
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
10
AA seq 445 aa
MMEWLFVFFLTDGREMAIGSSYAAFGTLLVHPLRRETTTPGVLGEGRRGLRVGTRGLVFR
VCVSGVGGRGRGRCESGKMAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEA
VQVKEQSILELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAA
TGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDD
KALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEE
KDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGR
QTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPF
SRVQVRISLGTLSTVLGYMLCCCPK
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgatggaatggttatttgtgttctttctcactgatggacgcgagatggcgatcgggagc
tcgtatgcggctttcgggacgctcctggtccacccgctccggagagaaactacaactccc
ggagtgctcggagaagggaggcggggtcttcgggtaggaacgcgagggctggtcttccgg
gtgtgtgtttccggcgtcggcggccgcggccggggacggtgtgagagcggtaagatggcg
gccgcagcggtggtagagttccagagagctcagtctctactcagcactgaccgggaggcc
tccatcgacatcctccactccatcgtgaagcgtgacattcaagaaaatgatgaggaggca
gtccaggtcaaagagcagagcatccttgaactggggtctctcctggcgaagactggacaa
gctgctgagcttggaggactcctgaagtatgtacgacctttcttgaattccatcagtaaa
gctaaagcagctcgtctggtccggtctcttcttgatctgtttctagatatggaagcagct
acagggcaggaggtcgagctatgtttagaatgcatcgaatgggccaaatcagagaaaaga
accttcttacgccaagcattggaggcaaggctggtgtctttgtattttgataccaagagg
taccaggaagcattacatttgggttctcagctgcttcgggagttgaaaaagatggatgat
aaagctcttttggttgaagtacagcttttagaaagcaaaacttaccatgctctgagtaat
ctgccgaaagcccgagctgccttaacctctgctcgaaccacagcaaatgctatctactgc
ccccctaaattgcaggccactctggacatgcagtcaggtattattcatgcagcagaggag
aaggactggaaaactgcatactcgtacttctatgaggcattcgaaggctatgactccatc
gatagccccaaggccatcacatctctgaagtacatgttgctgtgcaaaatcatgctcaac
accccagaagatgtccaggctttggtgagcggaaagcttgcacttcggtatgcagggagg
cagacagaagcattgaaatgtgtggctcaagctagcaagaacagatcactggcagatttt
gaaaaggccctgacagactacagggcggagctccgggacgacccaatcatcagcacacat
ttggccaagttgtacgataacttactggaacagaatctgatccgggtcattgaacctttc
tcccgagtacaggtcagaatctccctgggaactttgtcaacagttttgggctacatgttg
tgctgttgtccaaaatag

KEGG   Rattus norvegicus (rat): 307821
Entry
307821            CDS       T01003                                 

Gene name
Psmd7
Definition
(RefSeq) 26S proteasome non-ATPase regulatory subunit 7
  KO
K03038  26S proteasome regulatory subunit N8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    307821 (Psmd7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    307821 (Psmd7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    307821 (Psmd7)
   05012 Parkinson disease
    307821 (Psmd7)
   05014 Amyotrophic lateral sclerosis
    307821 (Psmd7)
   05016 Huntington disease
    307821 (Psmd7)
   05017 Spinocerebellar ataxia
    307821 (Psmd7)
   05020 Prion disease
    307821 (Psmd7)
   05022 Pathways of neurodegeneration - multiple diseases
    307821 (Psmd7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    307821 (Psmd7)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     307821 (Psmd7)
SSDB
Motif
Pfam: MitMem_reg JAB Coilin_N Connexin
Other DBs
NCBI-GeneID: 307821
NCBI-ProteinID: NP_001100896
RGD: 1306902
Ensembl: ENSRNOG00000014097
UniProt: D4AEH3
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
19
AA seq 320 aa
MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDE
DDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSV
LVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIK
DTTVGTLSQRITNQVHGLKGLNSKLLDIRTYLEKVASGKLPINHHIIYQLQDVFNLLPDA
SLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEESKKER
KDDKEKEKSDAKKEEKKEKK
NT seq 963 nt   +upstreamnt  +downstreamnt
atgccggagctggcggtgcagaaagtggtggtccaccccctggtgctgctcagtgtggtg
gatcatttcaaccgaatcggcaaggttggaaaccagaagcgggttgttggtgtgcttttg
ggatcatggcaaaagaaagtccttgatgtatccaacagctttgcagtaccttttgatgaa
gatgacaaagatgattctgtctggtttttagaccatgattatttggaaaacatgtatggg
atgtttaagaaggtcaatgccagagaaagaatagttgggtggtaccacacaggccccaaa
ctgcacaagaacgatatcgccatcaatgaactcatgaagagatactgccccaactcggta
ctggtcattattgatgtgaagccaaaagacttggggcttccgaccgaagcctacatctca
gtggaggaagttcatgatgacggaacaccaacatcaaaaacttttgagcacgtgactagt
gaaattggagcagaggaggctgaggaggttggagtggagcacttgttacgggacatcaag
gacactacagtggggactctgtctcagaggatcactaaccaggtccatggtttgaaggga
ctgaactccaagctcctggatatcaggacctacctggagaaggtagccagcggcaagcta
cccatcaaccaccacatcatataccagctgcaggacgtcttcaacctgctgccggacgcc
agcctgcaggagttcgtcaaggccttctacctgaagaccaatgaccagatggttgtggtg
tacctggcctcgctgatccgctctgtggtcgccttgcataacctcatcaacaacaagatt
gccaaccgcgatgcggagaagaaagagggacaggagaaggaggagagcaagaaggagaga
aaagacgacaaggagaaggagaagagcgatgcgaagaaagaggagaaaaaggagaaaaag
taa

KEGG   Rattus norvegicus (rat): 311078
Entry
311078            CDS       T01003                                 

Gene name
Psmd14
Definition
(RefSeq) 26S proteasome non-ATPase regulatory subunit 14
  KO
K03030  26S proteasome regulatory subunit N11
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    311078 (Psmd14)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    311078 (Psmd14)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    311078 (Psmd14)
   05012 Parkinson disease
    311078 (Psmd14)
   05014 Amyotrophic lateral sclerosis
    311078 (Psmd14)
   05016 Huntington disease
    311078 (Psmd14)
   05017 Spinocerebellar ataxia
    311078 (Psmd14)
   05020 Prion disease
    311078 (Psmd14)
   05022 Pathways of neurodegeneration - multiple diseases
    311078 (Psmd14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    311078 (Psmd14)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    311078 (Psmd14)
   03051 Proteasome [BR:rno03051]
    311078 (Psmd14)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M67
   311078 (Psmd14)
Ubiquitin system [BR:rno04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   JAMM
    311078 (Psmd14)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     311078 (Psmd14)
SSDB
Motif
Pfam: JAB MitMem_reg Prok-JAB DUF4525
Other DBs
NCBI-GeneID: 311078
NCBI-ProteinID: NP_001020860
RGD: 1594532
Ensembl: ENSRNOG00000061129
UniProt: Q4V8E2
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
3
AA seq 310 aa
MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGE
FVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGC
WLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSN
LGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKH
NESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCL
AAMLDTVVFK
NT seq 933 nt   +upstreamnt  +downstreamnt
atggacagacttcttagacttggaggaggtatgcctggactgggccagggtccacctaca
gatgcccctgccgtagacacagcagaacaagtttacatctcctccttggcgttgctaaag
atgttaaaacatggccgtgctggggttcctatggaagttatgggtctaatgcttggcgaa
tttgttgatgattacaccgtcagagtgattgatgtgtttgctatgccacaatcaggaact
ggtgtcagtgtagaagcagttgatccagtgttccaagccaaaatgttggatatgctgaaa
caaacaggaaggcccgagatggttgttggttggtatcacagtcaccctggctttggctgt
tggctttctggtgtggacatcaacactcagcagagctttgaagccttgtcggagagagct
gtggcagtggttgtggatcccattcagagtgtgaaaggaaaggttgttattgatgccttc
agactgatcaatgctaatatgatggtcttaggacatgaaccgagacaaacgacttccaat
ctgggccacttaaacaagccatctatccaggcattaattcacggattaaacagacattac
tactccatcactattaattatcggaaaaatgaactggaacagaagatgctgttaaatttg
cataagaagagttggatggaaggattgacacttcaggactacagtgaacattgtaaacac
aatgaatcggtggtaaaagagatgttggaattagccaagaattataataaggctgtagaa
gaggaagataagatgacgcctgaacagctggcaataaagaatgtgggcaagcaggatccc
aaacgtcatttggaagagcatgtggatgtgcttatgacttcaaatattgtccagtgtttg
gcagcaatgttggataccgttgtatttaaataa

KEGG   Rattus norvegicus (rat): 365388
Entry
365388            CDS       T01003                                 

Gene name
Psmd13
Definition
(RefSeq) 26S proteasome non-ATPase regulatory subunit 13
  KO
K03039  26S proteasome regulatory subunit N9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    365388 (Psmd13)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    365388 (Psmd13)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    365388 (Psmd13)
   05012 Parkinson disease
    365388 (Psmd13)
   05014 Amyotrophic lateral sclerosis
    365388 (Psmd13)
   05016 Huntington disease
    365388 (Psmd13)
   05017 Spinocerebellar ataxia
    365388 (Psmd13)
   05020 Prion disease
    365388 (Psmd13)
   05022 Pathways of neurodegeneration - multiple diseases
    365388 (Psmd13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    365388 (Psmd13)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     365388 (Psmd13)
SSDB
Motif
Pfam: PCI Rpn9_C PARP_reg
Other DBs
NCBI-GeneID: 365388
NCBI-ProteinID: NP_001102395
RGD: 1305236
Ensembl: ENSRNOG00000014109
UniProt: B0BN93
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
1
AA seq 376 aa
MKDVPAFLQQSQSSGPGQAAVWHRLEELYTKKLWHQLTLQVLDFVQDPCFAQGDGLIKLY
ENFISEFEHRVNPLSLVEIILHVVRQMTDPNVALTFLEKTREKVKSSDEAVILCKTAIGA
LKLNIGDLQATKETIEDVEEMLNNLPGVTSVHSRFYDLSSKYYQTIGNHASYYKDALRFL
GCVDIKDLPVSEQQERAFTLGLAGLLGEGVFNFGELLMHPVLESLRNTDRQWLIDTLYAF
NSGDVDRFQTLKSAWGQQPDLAANEAQLLRKIQLLCLMEMTFTRPANHRQLTFEEIAKSA
KITVNKVELLVMKALSVGLVRGSIDEVDKRVHMTWVQPRVLDLQQIKGMKDRLELWCTDV
KSMELLVEHQAQDILT
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgaaggatgtgccggccttcttacagcagagtcagagctccgggccgggccaggccgcc
gtttggcaccgtttggaagagctatacacgaagaagttatggcatcagctgacacttcag
gtgcttgattttgtgcaggacccatgctttgcccaaggagatggcctcattaagctctat
gaaaacttcatcagtgaatttgagcacagggtaaaccctttgtccctggtagaaataatt
cttcatgtggttagacagatgaccgatcctaatgtggctcttacttttctggaaaagact
cgtgagaaggtaaaaagtagtgatgaagccgtgatcttgtgtaagacagcaatcggagct
ctaaaattgaacatcggggatctgcaggctacaaaggaaaccattgaagatgttgaagag
atgctcaacaatctccctggtgtgacgtcagttcacagtcgtttctacgatctctccagt
aaatactatcaaacaatcggaaaccacgcgtcctactacaaagatgccctacggtttctg
ggctgtgtagacataaaggatctgccagtatcagaacagcaagaaagagccttcacactg
gggcttgctggacttctcggagagggagtttttaactttggagaacttctcatgcatcct
gtgctggagtcactgaggaacactgaccggcagtggctgattgacaccctgtatgctttc
aacagtggtgatgtagataggttccagacactgaagtctgcctggggccagcagcctgac
ttagcagccaacgaggcccagcttctgaggaagatccagctgttgtgccttatggagatg
acgttcacacggcctgccaaccacagacaactcacttttgaggaaattgccaaaagtgcc
aagatcactgtcaacaaggtggagctgttggtgatgaaggcactctcggtggggctggtg
agaggcagcatagacgaggtggacaagcgggttcacatgacgtgggtgcagcctcgagtg
ctggatttgcagcagatcaaggggatgaaggaccgtctggagctctggtgcactgatgtg
aagagcatggagctgctggtagaacaccaggctcaagacatcctcacctaa

KEGG   Rattus norvegicus (rat): 65138
Entry
65138             CDS       T01003                                 

Gene name
Adrm1
Definition
(RefSeq) proteasomal ubiquitin receptor ADRM1
  KO
K06691  26S proteasome regulatory subunit N13
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    65138 (Adrm1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    65138 (Adrm1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    65138 (Adrm1)
   05012 Parkinson disease
    65138 (Adrm1)
   05014 Amyotrophic lateral sclerosis
    65138 (Adrm1)
   05016 Huntington disease
    65138 (Adrm1)
   05017 Spinocerebellar ataxia
    65138 (Adrm1)
   05020 Prion disease
    65138 (Adrm1)
   05022 Pathways of neurodegeneration - multiple diseases
    65138 (Adrm1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    65138 (Adrm1)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     65138 (Adrm1)
SSDB
Motif
Pfam: RPN13_C Proteasom_Rpn13 GerD ASXH
Other DBs
NCBI-GeneID: 65138
NCBI-ProteinID: NP_113896
RGD: 69248
Ensembl: ENSRNOG00000055984
UniProt: Q9JMB5
Position
3
AA seq 407 aa
MTTSGALFPSLVPGSRGSSIKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFC
WKDRTSGTVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEH
CRKVNECLNNPPMPGTLGASGSSGHELSALGGEGGLQSLLGNMSHSQLMQLIGPAGLGGL
GGLGALTGPGLASLLGSSGPPASSSSSSSRSQSAAVTPSSTTSSARATPAPSAPAAASAT
SPSPAPSSGNGTSTAASPTQPIQLSDLQSILATMNVPAGPGGSQQVDLASVLTPEIMAPI
LANADVQERLLPYLPSGESLPQTAEEIQNTLTSPQFQQALGMFSAALASGQLGPLMCQFG
LPAEAVEAANKGDVEAFAKAMQNNAKSDPKEGDTKDKKDEEEDMSLD
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgacgacttcaggcgctctgttcccgagcctggttcccggctctcggggatcctctatc
aagtatttggtggagttccgggcaggaaaaatgtcattaaaaggaactacggtcacccca
gataaacggaaagggctcgtgtacatccagcagaccgacgattcccttattcacttctgt
tggaaagacaggacctctgggaccgtggaggatgacttgattatctttcctgatgactgt
gagttcaagcgggtgcctcagtgccccagtgggagggtctacgtgctcaagtttaaggca
gggtccaagcggctgttcttctggatgcaggagcccaagactgaccaagatgaggagcat
tgccggaaagtgaacgagtgtctgaacaacccccccatgcctgggacactgggagcgagt
gggagtagtggccacgagctttcagcactgggcggtgagggtggcctgcagagtctgttg
gggaacatgagtcacagccagcttatgcagctcatcggaccagccggcctcggaggactg
ggtgggcttggggccctcactgggccaggcctggccagcttgctggggagcagtgggcct
ccagccagcagctcctcatccagctcccggagccagtcggcagccgtcaccccgtcctct
accacctcttccgctcgcgccaccccagccccttctgccccagcagctgcctcggcgacc
agcccgagtcccgcacccagctcgggtaatggaaccagcacagcagccagcccgacccag
cccatccagctgagcgacctccagagcattctggccactatgaacgtcccagcagggcca
ggaggcagccagcaggtggatctggcgagtgtgctgacaccagagatcatggctcccatc
cttgccaacgcagacgttcaggagcgcctgctgccctacctgccctctggggagtctctg
ccccagactgcagaggagatccagaacacattaacctcgccccagttccagcaggccctg
ggtatgttcagtgcggccttggcctcaggacagcttggccctctcatgtgccagtttggc
cttcctgcagaggctgtcgaggccgccaacaaaggtgatgtggaagcatttgccaaagcc
atgcagaataatgccaaatcagaccccaaggagggcgacacaaaagacaagaaagacgaa
gaggaagatatgagtctagattaa

KEGG   Rattus norvegicus (rat): 680532
Entry
680532            CDS       T01003                                 

Gene name
Sem1
Definition
(RefSeq) 26S proteasome complex subunit DSS1
  KO
K10881  26 proteasome complex subunit DSS1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno03440  Homologous recombination
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    680532 (Sem1)
  09124 Replication and repair
   03440 Homologous recombination
    680532 (Sem1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    680532 (Sem1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    680532 (Sem1)
   05012 Parkinson disease
    680532 (Sem1)
   05014 Amyotrophic lateral sclerosis
    680532 (Sem1)
   05016 Huntington disease
    680532 (Sem1)
   05017 Spinocerebellar ataxia
    680532 (Sem1)
   05020 Prion disease
    680532 (Sem1)
   05022 Pathways of neurodegeneration - multiple diseases
    680532 (Sem1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    680532 (Sem1)
   04131 Membrane trafficking [BR:rno04131]
    680532 (Sem1)
   03051 Proteasome [BR:rno03051]
    680532 (Sem1)
   03400 DNA repair and recombination proteins [BR:rno03400]
    680532 (Sem1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    TREX-2 complex
     680532 (Sem1)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    680532 (Sem1)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     680532 (Sem1)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     680532 (Sem1)
SSDB
Motif
Pfam: DSS1_SEM1
Other DBs
NCBI-GeneID: 680532
NCBI-ProteinID: NP_001119562
RGD: 1590628
Ensembl: ENSRNOG00000010420
UniProt: D3ZHW9
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
4
AA seq 70 aa
MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAEL
EKHGYKMETS
NT seq 213 nt   +upstreamnt  +downstreamnt
atgtccgagaagaagcagcctgtcgacttgggtctcctggaagaggacgacgagttcgag
gagtttcccgcggaagactgggccggcttagatgaagatgaagatgcacatgtctgggag
gataattgggatgatgacaatgtagaagacgacttctccaatcagttacgcgctgagctg
gagaagcatggttacaagatggagacttcatag

KEGG   Rattus norvegicus (rat): 81827
Entry
81827             CDS       T01003                                 

Gene name
Psmc5
Definition
(RefSeq) 26S proteasome regulatory subunit 8
  KO
K03066  26S proteasome regulatory subunit T6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    81827 (Psmc5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    81827 (Psmc5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    81827 (Psmc5)
   05012 Parkinson disease
    81827 (Psmc5)
   05014 Amyotrophic lateral sclerosis
    81827 (Psmc5)
   05016 Huntington disease
    81827 (Psmc5)
   05017 Spinocerebellar ataxia
    81827 (Psmc5)
   05020 Prion disease
    81827 (Psmc5)
   05022 Pathways of neurodegeneration - multiple diseases
    81827 (Psmc5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    81827 (Psmc5)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     81827 (Psmc5)
SSDB
Motif
Pfam: AAA AAA_lid_3 Prot_ATP_ID_OB AAA_2 AAA_5 AAA_16 AAA_22 RuvB_N TIP49 AAA_33 AAA_18 AAA_3 Mg_chelatase ATPase PhoH IstB_IS21 AAA_28 AAA_24 AAA_14 Sigma54_activat AAA_17 DUF815 AAA_7 bpMoxR Parvo_NS1 AAA_25 Zeta_toxin RNA_helicase TsaE HR1 AAA_19 AAA_11
Other DBs
NCBI-GeneID: 81827
NCBI-ProteinID: NP_112411
RGD: 708376
Ensembl: ENSRNOG00000010038
UniProt: P62198
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
10
AA seq 406 aa
MALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLR
EELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDS
YTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGI
AQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMARE
HAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDI
LDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVK
GVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggcgcttgatgggccagagcagatggaactggaagaggggaaggcaggcagtggactc
cgtcaatattatctgtccaagattgaagaactccagttgattgtgaatgacaagagtcag
aacctccggagactgcaggcccagaggaatgagctcaatgcaaaagttcgtctgttgcgg
gaggaactgcagctgctgcaggaacagggctcctacgttggagaagtcgtgagggccatg
gataagaaaaaagtgttggtcaaggtccatcctgagggcaaatttgttgttgatgtggac
aagaacattgatatcaatgatgtgacacccaattgtcgggtggctctaagaaatgacagc
tacactctgcataagatcctgcctaacaaagtggaccctttggtatcactaatgatggtg
gaaaaggtgccagactcaacctacgagatgattggcgggctagacaagcagatcaaggag
atcaaagaagtgattgagctgcctgtgaagcaccctgagctctttgaagccctgggcatt
gcacagccaaagggagtcctgctatatggacccccgggcactgggaagacgttgttggcc
cgggctgtggctcatcatacggactgtacctttattcgtgtctctggctctgaactggta
cagaaattcattggggaaggggcaagaatggtgagggagctgtttgtcatggcccgagaa
catgctccctccatcatcttcatggacgagatcgactctatcggttcttcacggctggag
ggaggctctggaggcgacagtgaggtacagcgcacaatgctggaactgctcaaccagctg
gatggctttgaggccactaagaatatcaaggttatcatggctactaataggattgatatc
ctggactctgccctgcttcgtcctgggaggattgacaggaaaattgaattcccacctccc
aatgaggaggcccggctggacattttgaaaatccactctcggaaaatgaacttgaccagg
gggatcaacctgaggaaaattgctgagttgatgccaggagcttcaggggctgaagtgaag
ggcgtgtgcacagaggccggcatgtatgctctgcgggaacggcgtgtccacgttactcag
gaggactttgagatggcagtagccaaggtcatgcaaaaggatagtgagaaaaacatgtcc
atcaagaagctttggaagtga

KEGG   Rattus norvegicus (rat): 83499
Entry
83499             CDS       T01003                                 

Gene name
Psmd4
Definition
(RefSeq) 26S proteasome non-ATPase regulatory subunit 4
  KO
K03029  26S proteasome regulatory subunit N10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    83499 (Psmd4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    83499 (Psmd4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    83499 (Psmd4)
   05012 Parkinson disease
    83499 (Psmd4)
   05014 Amyotrophic lateral sclerosis
    83499 (Psmd4)
   05016 Huntington disease
    83499 (Psmd4)
   05017 Spinocerebellar ataxia
    83499 (Psmd4)
   05020 Prion disease
    83499 (Psmd4)
   05022 Pathways of neurodegeneration - multiple diseases
    83499 (Psmd4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    83499 (Psmd4)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     83499 (Psmd4)
SSDB
Motif
Pfam: VWA_2 VWA Ssl1 UIM RAP80_UIM
Other DBs
NCBI-GeneID: 83499
NCBI-ProteinID: NP_112621
RGD: 621109
Ensembl: ENSRNOG00000021042
UniProt: O88321
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
2
AA seq 380 aa
MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEV
LTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDN
EKDLVKLAKRLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLA
DALISSPILAGEGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAA
ASAAEAGIATPGTEGERDSDDALLKMTISQQEFGRAGLPDLSSMTEEEQIAYAMQMSLQG
AEFGQAESGDIDASSAMDTSEPVKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNAMG
SLASQATKDGKKDKKEEEKK
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggtgttggagagcactatggtttgtgtggacaacagtgagtacatgcggaatggagac
ttccttcccacccggctgcaggcccagcaggatgctgtcaacattgtatgtcactcaaag
acccgaagcaaccctgagaataacgtgggcttgatcacgctggccaatgactgtgaggtg
ctgaccacactcacccctgacactggccgaatcctctccaagctccacactgtccagccc
aaaggcaagatcaccttctgcactggcatccgcgtggcccatctggctctgaagcaccgg
cagggcaagaatcacaagatgcgcatcatcgccttcgtgggtagccctgtggaggacaac
gagaaggatctggtgaaactagctaaacgccttaagaaagaaaaagtgaatgttgacatc
atcaattttggggaagaggaggtgaacacagagaagctgacagcctttgtgaacacatta
aacggcaaggacggaactggatcacatctagtgacagtgcctcctgggcccagcctggcc
gatgctctcatcagttctcctattctagctggggaaggcggcgccatgctgggtcttggt
gccagtgactttgagtttggagtagatcccagtgctgatcctgaattggccctggccctt
cgtgtctctatggaagagcagcggcagcggcaggaggaggaggcacgacgggctgctgca
gcctctgcagctgaggctggaattgccacacctgggactgaaggtgaacgagactcagat
gatgccctactgaagatgaccatcagccagcaggagtttggccgtgcggggcttcctgac
ctaagcagcatgacagaggaagagcagattgcctatgccatgcagatgtccctgcaggga
gcagagtttggccaagcagaatcaggggacatcgatgccagctcagccatggacacatct
gagccagtcaaggaggaggatgactatgacgtgatgcaggacccagagttccttcagagc
gtcctagagaaccttcccggtgtggatcccaacaatgaagccattcgaaatgcaatgggc
tctctggcctcccaggccaccaaggatggcaagaaggacaagaaagaggaagagaagaag
tga

KEGG   Rattus norvegicus (rat): 83806
Entry
83806             CDS       T01003                                 

Gene name
Psmd1
Definition
(RefSeq) 26S proteasome non-ATPase regulatory subunit 1
  KO
K03032  26S proteasome regulatory subunit N2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    83806 (Psmd1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    83806 (Psmd1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    83806 (Psmd1)
   05012 Parkinson disease
    83806 (Psmd1)
   05014 Amyotrophic lateral sclerosis
    83806 (Psmd1)
   05016 Huntington disease
    83806 (Psmd1)
   05017 Spinocerebellar ataxia
    83806 (Psmd1)
   05020 Prion disease
    83806 (Psmd1)
   05022 Pathways of neurodegeneration - multiple diseases
    83806 (Psmd1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    83806 (Psmd1)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     83806 (Psmd1)
SSDB
Motif
Pfam: RPN2_C PC_rep HEAT_2 HEAT_EZ SPATIAL Tim54
Other DBs
NCBI-GeneID: 83806
NCBI-ProteinID: NP_114184
RGD: 621669
Ensembl: ENSRNOG00000017730
UniProt: O88761
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
9
AA seq 953 aa
MITSAAGIISLLDEEEPQLKEFALHKLNAVVNDFWAEISESVDKIEVLYEDEGFRSRQFA
ALVASKVFYHLGAFEESLNYALGAGDLFNVNDNSEYVETIIAKCIDHYTKQCVENADLPE
GEKKPIDQRLEGIVNKMFQRCLDDHKYKQAIGIALETRRLDVFEKTILESNDVPGMLAYS
LKLCMSLMQNKQFRNKVLRVLVKIYMNLEKPDFINVCQCLIFLDDPQAVSDILEKLVKED
NLLMAYQICFDLYESASQQFLSSVIQNLRTVGTPIASVPGSTNTGTVPGPEKDSDSMETE
EKTAGAVAGKTPDASPEPKDQTLKMIKILSGEMAIELHLQFLIRNNNTDLMILKNTKDAV
RNSVCHTATVIANSFMHCGTTSDQFLRDNLEWLARATNWAKFTATASLGVIHKGHEKEAL
QLMATYLPKDTSPGSAYQEGGGLYALGLIHANHGGDIIDYLLNQLKNASNDIVRHGGSLG
LGLAAMGTARQDVYDLLKTNLYQDDAVTGEAAGLALGLVMLGSKNAQAIEDMVGYAQETQ
HEKILRGLAVGIALVMYGRMEEADALIESLCRDKDPILRRSGMYTVAMAYCGSGNNKAIR
RLLHVAVSDVNDDVRRAAVESLGFILFRTPEQCPSVVSLLSESYNPHVRYGAAMALGVCC
AGTGNKEAINLLEPMTNDPVNYVRQGALIASALIMIQQTEITCPKVNQFRQLYSKVINDK
HDDVMAKFGAILAQGILDAGGHNVTISLQSRTGHTHMPSVVGVLVFTQFWFWFPLSHFLS
LAYTPTCVIGLNKDLKMPKVQYKSNCKPSTFAYPAPLEVPKEKEKEKVSTAVLSITAKAK
KKEKEKEKKEEEKMEVDEAEKKEEKEKKKEPEPNFQLLDNPARVMPAQLKVLSMTETCRY
QPFKPLSIGGIIILKDTSEDIEELVEPVAAHGPKIEEEEQEPEPPEPFEYIDD
NT seq 2862 nt   +upstreamnt  +downstreamnt
atgatcacttcagccgctggaattatttctcttctggatgaagaagagccacagctcaag
gaatttgcactacacaaattgaatgcagttgtgaatgacttctgggcagaaatttctgag
tctgtagacaaaatagaagttttatatgaagatgaaggtttccgcagtcggcagtttgca
gccttggtggcatcgaaagtattttatcacctgggggctttcgaggagtctctgaattat
gctcttggagcaggtgacctcttcaatgtcaatgataactctgaatatgtggagactatt
atagcaaaatgcattgatcattataccaaacagtgtgtggaaaatgcagatttgcctgaa
ggagaaaagaagccaattgaccagagattggaaggcatcgtgaataagatgttccagcga
tgtctcgatgatcacaagtataagcaagcgattggcattgctctggagaccaggagacta
gatgtctttgagaagactatactggaatctaatgatgtcccaggaatgctagcttacagc
ctcaagctctgcatgtctttaatgcagaataagcagtttcggaataaagtattgcgagtc
ctggttaaaatctacatgaacttggaaaaacctgatttcatcaatgtttgtcagtgctta
atcttcttagatgacccccaggccgtgagtgatatcttagaaaagctggtaaaggaagac
aacctgctgatggcctatcagatttgctttgatttgtacgaaagtgccagccagcagttt
ttgtcatctgtgatccagaatcttcgaactgttgggacccctattgcttctgtgcctgga
tctaccaatacgggtactgtgccaggaccagagaaagacagtgactctatggagaccgag
gagaagacagccggtgcagtggcagggaaaacaccagacgctagtccagagcccaaggac
cagacattgaaaatgattaaaattttaagtggtgaaatggctatcgagttacacctgcag
ttcctaatacgcaataataacacagacctcatgattctgaaaaacacaaaggatgcagta
cgaaattctgtatgtcatacagcaactgtaatagcaaactcattcatgcactgtgggact
accagtgaccagttccttagagataacttggaatggctggccagagccactaactgggcc
aaatttactgcaactgccagcttgggtgtaatccataagggccatgagaaggaagcacta
cagttaatggcaacatacctccctaaggacacttctccaggatcagcctatcaggaaggt
ggaggtctctatgcattgggtctcattcatgccaatcatggtggtgacataattgactat
ctccttaatcagctcaagaatgccagcaatgatatcgttagacatggaggcagcttgggc
cttggtttggctgcaatgggaactgcacgtcaggatgtatatgatttgctgaaaacaaac
ctgtatcaggatgatgctgtgacaggggaggcagctggcctggccttaggtttggttatg
ttaggctctaaaaacgcccaggcgattgaggatatggttggctatgcacaagaaactcaa
cacgagaagattctgcgtggtctagcagttggcattgcgttagtgatgtatgggaggatg
gaggaggccgatgctctcattgaatctctctgtcgtgataaggacccaattcttagaaga
tctggaatgtatactgtagccatggcttattgtggctctggtaacaataaagctattcga
cgcctgctgcatgttgctgtaagtgatgtcaacgatgatgtcagaagagcagcagtagag
tctcttggcttcattttgttcaggacgcctgaacagtgtccaagtgtggtctctttgttg
tccgagagttataaccctcatgtgcgctacggcgctgcaatggccctgggagtctgctgt
gctggtacaggaaacaaggaagcaattaatttactggagccaatgaccaatgaccctgtg
aactacgtgcggcaaggggctctgatagcctcagctctcatcatgatccaacagaccgaa
atcacgtgtccaaaggtaaaccagttccggcagctgtattccaaagtcatcaatgacaag
catgatgatgtcatggccaaatttggcgctattctggcccaaggcatactggatgcaggt
ggtcataatgtcacaatctccttacagtccaggactgggcacactcatatgccttctgtg
gttggcgtccttgtctttacccagttctggttctggtttcccctttcacacttcctatca
ttggcttatactcctacctgtgtcatcggccttaacaaggatttaaagatgccgaaagtt
caatataaatcaaattgtaaaccatccacattcgcataccctgcccctctggaagttcca
aaagaaaaagaaaaggaaaaggtttccaccgctgtgttgtctattactgccaaagctaaa
aaaaaagaaaaagaaaaagaaaaaaaggaggaggagaagatggaagtggacgaagcagaa
aagaaggaagagaaagagaagaaaaaagaaccggaaccaaacttccagctgttggataat
ccagcacgggtcatgcctgcccagctgaaggtcttaagtatgacagagacctgcagatac
caacccttcaagccactctccatcgggggcatcataattctgaaagacaccagcgaagac
attgaggaacttgtggaacccgtggcagcacatggcccaaagattgaagaggaggagcag
gagccagagcccccagagccatttgagtacatcgatgactag

DBGET integrated database retrieval system