KEGG   Rattus norvegicus (rat): 117264Help
Entry
117264            CDS       T01003                                 

Gene name
P2ry6, P2y6
Definition
(RefSeq) pyrimidinergic receptor P2Y6
  KO
K04272  P2Y purinoceptor 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    117264 (P2ry6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    117264 (P2ry6)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    117264 (P2ry6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv PUCC Abhydrolase_9_N
Motif
Other DBs
NCBI-GeneID: 117264
NCBI-ProteinID: NP_476465
RGD: 620269
Ensembl: ENSRNOG00000019270
UniProt: Q63371
Position
1q32
AA seq 328 aa AA seqDB search
MERDNGTIQAPGLPPTTCVYREDFKRLLLPPVYSVVLVVGLPLNVCVIAQICASRRTLTR
SAVYTLNLALADLLYACSLPLLIYNYARGDHWPFGDLACRLVRFLFYANLHGSILFLTCI
SFQRYLGICHPLAPWHKRGGRRAAWVVCGVVWLVVTAQCLPTAVFAATGIQRNRTVCYDL
SPPILSTRYLPYGMALTVIGFLLPFTALLACYCRMARRLCRQDGPAGPVAQERRSKAARM
AVVVAAVFVISFLPFHITKTAYLAVRSTPGVSCPVLETFAAAYKGTRPFASANSVLDPIL
FYFTQQKFRRQPHDLLQKLTAKWQRQRV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggagcgggacaatggcaccatccaggctccaggcttgccgcccaccacctgcgtctac
cgtgaggatttcaagcgactgctgctacccccagtttactcagtggtgctggtggtcggc
ctgccactgaacgtctgtgtcatcgcccagatatgcgcatcccgccggaccctgacccgt
tccgctgtgtacaccctgaacttggcactggcggacctgctgtatgcctgttcactgccc
ctacttatctataactacgccagaggggaccactggcccttcggagaccttgcctgccgc
ctggtacgcttcctcttctatgccaacctacacggcagcatcctgttcctcacctgcatt
agcttccagcgatacctaggcatctgccatcccctggccccctggcacaagcgtggaggt
cgccgtgctgcttgggtggtatgtggagtcgtttggctggttgtgacagcccagtgcctg
cccacagcagtctttgccgccacgggcatccagcgcaaccgcactgtctgctacgacctg
agcccacccatcctgtccacccgctacctgccgtatggcatggccctcacggtcatcggc
ttcttgcttcccttcacagccttactggcctgctactgtcgcatggcccgccgcctgtgt
cgccaggatggcccagcaggtcctgtggcccaagagcgtcgcagcaaggcggcccgtatg
gctgtcgtggtagcagctgtctttgttatcagcttcctgcctttccacatcaccaagaca
gcctacttggctgtgcgctccacgcccggcgtctcttgcccggtactggagaccttcgct
gcagcctacaaaggcacccggcccttcgccagtgctaacagcgttctggaccctatcctc
ttctacttcacacaacagaagttccggcggcaaccacacgatctcctacagaagctcaca
gccaagtggcagaggcagagagtctga

DBGET integrated database retrieval system