KEGG   Rattus norvegicus (rat): 117267Help
Entry
117267            CDS       T01003                                 

Gene name
Slc26a2, Dtdst
Definition
(RefSeq) solute carrier family 26 member 2
  KO
K14701  solute carrier family 26 (sulfate anion transporter), member 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    117267 (Slc26a2)
Transporters [BR:rno02000]
 Solute Carrier Family (SLC)
  SLC26: Multifunctional anion exchanger
   117267 (Slc26a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sulfate_transp STAS STAS_2
Motif
Other DBs
NCBI-GeneID: 117267
NCBI-ProteinID: NP_476468
RGD: 620622
Ensembl: ENSRNOG00000018082
UniProt: O70531
Position
18q12.1
AA seq 739 aa AA seqDB search
MSSENKEQHNLSPRDLPEEAYGFPPELPLGAQRGSSTDLRQFEPSDRRRAFRRIHMELHE
KPDTNIRQLVMRKLQKSCQCNATKIRNRIFDFFPVLRWLPKYDLKKNILGDMMSGLIVGI
LLVPQSIAYSLLAGQEPIYGLYTSFFASIIYFLFGTSRHISVGIFGILCLMIGEVVDREL
HKACPDIDTTSSSIAMFSNGCVVVNHTLDGLCDKSCYAIKIGSTVTFMAGVYQVAMGFFQ
VGFVSVYLSDALLSGFVTGASFTILTSQAKYLLGLSLPRSNGVGSVITTWIHIFRNIHKT
NICDLITSLLCLLVLVPTKELNEYFKSKLPAPIPTELIVVVAATLASHFGKLNENYNSSI
AGQIPTGFMPPQAPDWSLIPNVAVDAIAISIIGFAITVSLSEMFAKKHGYTVKANQEMYA
IGFCNIIPSFFHCITTSAALAKTLVKESTGCQTQLSAIVTSLVLLLVLLLIAPLFYSLQK
CVLGVITIVNLRGALLKFRDLPKMWRLSRMDTVIWFVTMLSSALLSTEIGLLVGVCFSMF
CVILRTQMPKISLLGLEEESEIFESISTYKNLRSKSGIKVFRFIAPLYYINKECFKSALY
KKTLNPVLVKAAWKKAAKRKLKEETVTFHGDPDEVSMQLSHDPLELHTVVIDCSAIQFLD
TAGIHTLKEVRRDYEAIGIQVLLAQCNPSVRDSLAKGEYCKKEEENLLFYSLSEAVAFAE
ESQKEKGVCVVNGLSLSGD
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcagaaaataaagagcagcataatctttcaccaagggacttacctgaagaagcc
tatggcttcccacctgagctccccctgggggctcaaagaggatcaagcactgacttaagg
cagtttgagcccagtgatcggagaagagcttttcgtaggatccacatggaactccatgag
aaaccagatactaacatcagacagcttgtcatgagaaagcttcagaagagttgccagtgt
aatgcaaccaaaatcagaaataggatttttgatttttttcctgttttgaggtggctccca
aaatatgatctgaagaaaaacattttaggtgacatgatgtctggcctgattgtgggtata
ttgttggtgccccagtctattgcttactccctgttggctggccaggaacctatctatggt
ctgtacacatcattttttgccagcattatttacttcctgtttggtacctcccgccacatc
tctgtgggcatttttggaatactgtgccttatgattggtgaggtagttgaccgagaacta
cataaagcctgccctgacattgatactacatcatcttccatagcaatgttttcaaatgga
tgtgtggtagtaaaccatacattagacggactctgtgacaaaagctgttatgcaattaaa
attggcagcactgtgacattcatggctggagtttatcaggtagccatgggcttctttcaa
gtgggctttgtgtctgtctacctctcagatgccttgctgagcgggtttgtcactggtgcc
tccttcaccatcctcacgtctcaggccaagtacctcctggggctgagccttcctcggagc
aatggtgtaggctcagtcattactacctggatccacatcttcagaaatattcataagacc
aacatctgtgacctcatcaccagccttttgtgtctcctggtccttgtgccaaccaaagaa
ctcaacgaatacttcaagtccaagctcccggcaccaattccaactgagctcattgtcgtt
gtggcagccacattggcttctcattttggaaaactcaatgagaattacaattccagtatt
gccgggcaaattcccaccgggtttatgccaccccaagcgccagactggagcctcattcct
aatgtggctgttgatgccatagctatttctatcattggttttgctatcactgtatcactt
tctgagatgtttgccaagaaacatggctacacggtgaaagccaatcaggaaatgtatgcc
attggcttttgcaatatcataccctccttcttccactgcataactactagtgccgccctt
gcaaagacactggttaaagagtcaacaggttgccagacccaactgtccgctatagtgaca
tccctcgttcttctgttggtccttctgctaatagctcccttattctattccctccaaaaa
tgtgtccttggtgtgatcaccattgtaaatctccggggtgcacttctgaaatttagagac
ctgccaaagatgtggaggctcagcagaatggacacagttatctggtttgtgacgatgctg
tcctctgctctgttaagcactgaaataggcctgctcgttggggtttgtttttcaatgttt
tgtgtgattctccgtactcagatgccaaagatttcactgcttggtttggaagaagaatct
gaaatcttcgagtccatctccacttacaagaaccttcggagtaagtcaggcatcaaggtt
ttccgcttcatagcccctctctactacataaacaaagaatgctttaaatcagctttgtac
aagaaaacgctaaacccagtcttggtaaaagcagcctggaaaaaggcagcaaaaaggaaa
ctgaaagaggaaacagtgactttccatggggacccggatgaagtctcaatgcagctttcc
catgatcccttggagctgcacaccgttgtgattgactgtagtgcaatacagtttttggat
acagcagggatccacacactgaaagaagttcgccgggattatgaagccattggtatccag
gttttactggctcagtgcaatccttctgtgagggattccttagccaaaggagaatattgc
aaaaaggaagaagaaaatcttctcttctacagtttgtctgaagcagtagcttttgcagaa
gagtctcagaaggagaaaggagtgtgtgtggtcaatggtttgagtctttctggtgactga

DBGET integrated database retrieval system