KEGG   Rattus norvegicus (rat): 117269
Entry
117269            CDS       T01003                                 

Gene name
Rps6ka2
Definition
(RefSeq) ribosomal protein S6 kinase alpha-2
  KO
K04373  ribosomal protein S6 kinase alpha-1/2/3/6 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04114  Oocyte meiosis
rno04150  mTOR signaling pathway
rno04714  Thermogenesis
rno04720  Long-term potentiation
rno04722  Neurotrophin signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04931  Insulin resistance
rno05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    117269 (Rps6ka2)
   04150 mTOR signaling pathway
    117269 (Rps6ka2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    117269 (Rps6ka2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    117269 (Rps6ka2)
  09156 Nervous system
   04720 Long-term potentiation
    117269 (Rps6ka2)
   04722 Neurotrophin signaling pathway
    117269 (Rps6ka2)
  09159 Environmental adaptation
   04714 Thermogenesis
    117269 (Rps6ka2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    117269 (Rps6ka2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    117269 (Rps6ka2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    117269 (Rps6ka2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    117269 (Rps6ka2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     117269 (Rps6ka2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   117269 (Rps6ka2)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     117269 (Rps6ka2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like ABC1 Kdo Pkinase_fungal APH Pkinase_C TCAD9 Haspin_kinase RIO1 YrbL-PhoP_reg
Other DBs
NCBI-GeneID: 117269
NCBI-ProteinID: NP_476469
RGD: 620676
Ensembl: ENSRNOG00000013194
UniProt: F1M7N7
Position
1
AA seq 733 aa
MELNMKKFTVRRFFSVYLRKKSRSKSSSLSRLEEEGIVKEIDISSHVKEGFEKADPSQFE
LLKVLGQGSYGKVFLVRKVTGSDAGQLYAMKVLKKATLKVRDRVRSKMERDILAEVNHPF
IVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHGLGI
IYRDLKPENILLDEEGHIKITDFGLSKEAIDHDKRAYSFCGTIEYMAPEVVNRRGHTQSA
DWWSFGVLMFEMLTGSLPFQGKDRKETMALILKAKLGMPQFLSAEAQSLLRALFKRNPCN
RLGAGVDGVEEIKRHPFFVTIDWNKLYRKEIKPPFKPAVGRPEDTFHFDPEFTARTPTDS
PGVPPSANAHHLFRGFSFVASSLVQEPSQQDVPKAPIHPIVQQLHGNNIHFTDGYEIKED
IGVGSYSVCKRCVHKATDAEYAVKIIDKSKRDPSEEIEILLRYGQHPNIITLKDVYDDGK
YVYLVMELMRGGELLDRILRQRCFSEREASDVLYTIARTMDYLHSQGVVHRDLKPSNILY
MDESGNPESIRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDAACDVWSLGIL
LYTMLAGFTPFANGPDDTPEEILARIGSGKYALSGGNWDSISDAAKDVVSKMLHVDPQQR
LTAVQVLKHPWIVNREYLSQNQLSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSSLA
QRRGMKRLTSTRL
NT seq 2202 nt   +upstreamnt  +downstreamnt
atggagctgaacatgaagaagttcacggtgcgcaggttcttctcagtgtacctgcgcaag
aagtcgcgctccaagagctccagtctgagtcgcctcgaggaagaaggcatcgtgaaggag
attgacattagcagccatgtgaaggaaggcttcgagaaggcagacccctcccagttcgag
ctgctaaaagttttaggacaagggtcgtatggaaaggtgttcttggtgaggaaagtcaca
ggatcggatgctggtcagctctacgccatgaaagtcctgaagaaagccaccttgaaagtg
cgggaccgggtccggtctaagatggagagagatatcctggcagaggtgaatcaccctttc
atcgtcaagctgcattacgcctttcagaccgaaggcaagctctacctgatcctggacttc
ctgcggggaggagacctcttcaccaggctttccaaagaggtgatgtttacggaggaggat
gttaagttctacctggctgagctggccttggctctggaccacctccacggcctagggatc
atctacagggatctgaagcctgaaaatatcctcctggatgaagagggacatattaagatc
acagattttggcttgagcaaggaggccatcgaccatgacaagagagcctattcattttgt
gggactattgaatacatggcgcccgaggtggtgaaccggcgtggacacacacagagtgct
gactggtggtcctttggtgtgctcatgttcgagatgctcacaggatccctgccgtttcag
gggaaggacaggaaggaaacaatggccctcatcctcaaagccaagctgggcatgcctcag
ttcctcagtgcggaggcacagagcctgctgagagcccttttcaagcggaatccctgtaac
cggctaggtgctggtgttgacggagtggaggaaattaaacgtcacccgttctttgtcacc
atagactggaataagctgtatcgcaaggaaatcaagccacccttcaagccagcagtggga
aggcctgaggacaccttccactttgaccccgagtttactgcaaggacccccacagactct
cctggtgtccccccaagtgcaaacgcccaccacctgttcagggggttcagctttgtggcc
tccagcctggtccaggagccttcacagcaagacgtgcccaaggcccccattcacccgatt
gtgcagcagttacatgggaacaatatccacttcactgatggctacgagatcaaggaggac
atcggggtgggctcctactcagtgtgcaagcggtgtgtacacaaagccacggatgccgag
tacgccgtgaagatcatcgataagagcaaaagggatccctcagaggagattgagatcctc
ctgcggtatggccaacaccccaacatcatcaccctaaaagatgtctatgatgatggaaaa
tacgtatacctggtgatggagctcatgcgaggtggggagctgctggaccgcatcctccgc
cagcggtgcttctcagagcgggaggccagtgatgtgctgtacaccatcgccaggaccatg
gactacctgcactcccaaggggttgttcatcgggacctgaaaccaagtaacattctgtac
atggatgaatctggaaaccccgaatctatccgcatctgtgactttgggtttgccaaacag
ctgcgagcagaaaatggactgctcatgaccccctgctatactgcgaacttcgtggctcct
gaggtcctgaagcggcaaggctacgacgcagcgtgtgatgtctggagcctgggaatcctg
ctgtacaccatgctggctgggttcaccccttttgctaatgggccagacgatacccccgag
gagattctggcgaggattggcagtgggaagtacgccctttctggaggaaactgggactcc
atatcggatgcagcaaaggacgtcgtgtccaagatgctccacgtggacccgcagcaacgc
ctaacagcagttcaagtgttgaagcacccatggatcgtgaacagagagtacctatcccaa
aaccagctgagcagacaggacgtccatctagtgaagggtgccatggcagccacctacttt
gctctgaacaggaccccacaggcgccgaggctggagcctgtgctctcctctagcttggcc
caacgcagaggcatgaagagactcacgtctacccggttgtag

KEGG   Rattus norvegicus (rat): 317203
Entry
317203            CDS       T01003                                 

Gene name
Rps6ka6
Definition
(RefSeq) ribosomal protein S6 kinase alpha-6
  KO
K04373  ribosomal protein S6 kinase alpha-1/2/3/6 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04114  Oocyte meiosis
rno04150  mTOR signaling pathway
rno04714  Thermogenesis
rno04720  Long-term potentiation
rno04722  Neurotrophin signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04931  Insulin resistance
rno05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    317203 (Rps6ka6)
   04150 mTOR signaling pathway
    317203 (Rps6ka6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    317203 (Rps6ka6)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    317203 (Rps6ka6)
  09156 Nervous system
   04720 Long-term potentiation
    317203 (Rps6ka6)
   04722 Neurotrophin signaling pathway
    317203 (Rps6ka6)
  09159 Environmental adaptation
   04714 Thermogenesis
    317203 (Rps6ka6)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    317203 (Rps6ka6)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    317203 (Rps6ka6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    317203 (Rps6ka6)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    317203 (Rps6ka6)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     317203 (Rps6ka6)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   317203 (Rps6ka6)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     317203 (Rps6ka6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like ABC1 Kdo Pkinase_fungal Pkinase_C APH YrbL-PhoP_reg Haspin_kinase
Other DBs
NCBI-GeneID: 317203
NCBI-ProteinID: NP_001178650
RGD: 1560817
Ensembl: ENSRNOG00000002592
UniProt: F1LYL8
Position
X
AA seq 860 aa
MLNFRRTRHTPSGHRSNSSLNLFCCFPFFGCRRQSRSRQRAGTPVVPLLRYPPLARSAVT
QRESWSYEEDHEPAQQAGCMLVLGTSSFFSSVPEAAMLPFAPVEDPWDEEMEVFGSGSTS
SSEPQIVFTMKTAAMVIRQHEHKEVNDLKMVDEPMDEGEPVFCRREDLVKEIPITQHVKE
GYEKADPAQFDLLKVLGQGSFGKVFLVRKKTGPDAGQLYAMKVLRKASLKVRDRVRTKME
RDILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDVFTRLSKEVLFTEEDVKFYLAELA
LALDHLHRLGIVYRDLKPENILLDEIGHIKLTDFGLSKESVDQEKKAYSFCGTVEYMAPE
VVNRRGHSQSADWWSYGVLMFEMLTGTLPFQGKDRNETMNMILKAKLGMPQFLSAEAQSL
LRMLFKRNPANRLGSEGVEEVKRHAFFSSIDWNKLYKREVQPPFRPASGKPDDTFCFDPE
FTAKTPKDSPGLPASANAHQLFKGFSFVATSIAEEYKITPVTSSNVLPIVQINGNAAQFS
EAYELKEDIGIGSYSVCKRCIHSASNMEFAVKIIDKNKRDPSEEIEILMRYGQHPNIISL
KEVFDDGKYVYLVTDLMKGGELLDRILKKKCFSEQEASNVLYVITKTVEYLHSQGVVHRD
LKPSNILYMDESGHPDSIKICDFGFAKQLRGENGLLLTPCYTANFVAPEVLTQQGYDAAC
DIWSLGVLLYTMLAGYTPFSNGPNDTPEEILLRIGNGRFSLSGGIWDNISRGAKDLLSHM
LHMDPHQRYTAEQVLKHPWITQREQLPRHQPTSDDPPQEAVAAAYSVLARNQNRHPILEP
VAASRLAQRRNMKKRTSTGL
NT seq 2583 nt   +upstreamnt  +downstreamnt
atgctgaattttagaaggacacgacacacaccatctggccacaggtccaactctagcttg
aacctgttctgttgctttccgttttttggatgtcgtcgacaatccaggagtcggcagcgg
gcggggacccctgtggtccctcttttgaggtacccgcctttggcgaggtcagcagtcacc
cagcgcgagtcctggtcctacgaagaagaccacgagccagctcagcaggcgggatgcatg
ctggtgctggggacaagcagcttcttttcgagtgttcctgaagcggcgatgctaccattc
gctcctgtggaggatccctgggacgaagaaatggaggtgttcggcagtggcagcacgagc
agtagcgagccacagattgtgtttaccatgaagactgcggcgatggttattcgacagcat
gaacacaaagaggtaaatgatcttaaaatggttgatgaaccaatggatgagggagagcca
gttttttgccggcgggaagatttggttaaagaaatccctattacacagcatgttaaagaa
ggatatgagaaagcagatcccgcacagttcgacttgctcaaggttcttggtcagggatct
tttggaaaggtttttcttgttagaaagaagactggtcctgatgctgggcagctctatgca
atgaaggtgttaagaaaagcttctttgaaggttcgagaccgtgttcgcacaaagatggag
agggatatactggtagaagtaaatcatccttttatcgtcaaactgcactatgcttttcag
actgaagggaagctgtacttaatattggatttcctcaggggaggagatgtcttcacaaga
ttatccaaagaggttctttttacagaggaagatgtgaaattctaccttgcggaattggcc
ctagctttggatcatctgcatcgattaggaattgtgtatagagacctgaagccagagaac
atcttgcttgacgaaataggacatatcaagttaacagattttgggctgagcaaagagtca
gtggatcaagaaaagaaagcctactccttctgtggtactgtagaatacatggcccccgaa
gtagtaaatcgaagaggccattctcagagtgctgattggtggtcatatggtgtacttatg
tttgaaatgcttactggcacattgccatttcaagggaaagacagaaatgagaccatgaat
atgatactgaaagcaaaacttggaatgccccaattccttagtgctgaagcacaaagcctt
ttaaggatgttattcaaaaggaatccagcaaatagattgggatcagaaggagttgaagaa
gtcaaaagacatgcttttttctcttccattgactggaataaattatataaaagagaagtt
cagcctcctttcagacctgcttctggaaaaccagatgatactttttgttttgatcctgaa
tttactgccaaaacacctaaagattctcctggtttgccagccagcgcaaatgctcatcaa
ctcttcaaaggattcagttttgttgcgacttctatcgcagaagaatataaaatcactcct
gttacaagttcaaatgtattgccaatcgttcagataaatggaaatgctgctcaatttagt
gaagcgtatgagttgaaagaggatattggtattggatcttactctgtttgcaagcgatgc
atacattcagcttccaacatggaatttgcagttaagatcattgataaaaataagagagac
ccctcagaagaaattgaaattctgatgcgctatggacaacatcccaacattatctcttta
aaggaggtctttgatgatgggaaatatgtttaccttgttacggacttgatgaaaggagga
gaacttctggatcgcattctcaaaaagaaatgtttctcagagcaggaagctagtaatgtg
ctgtatgtaattaccaagacagttgaataccttcattctcaaggagtcgttcatcgtgat
cttaagcccagtaatattttgtacatggatgaatcaggccatccagattcaatcaagatc
tgtgactttggatttgcaaaacagcttcgaggagaaaatggacttctgttaactccatgc
tacactgcaaactttgtagcccctgaggttctcactcaacagggatatgatgctgcctgt
gatatttggagcttaggagtccttttgtacacaatgttggctggctacactccattttca
aatggacccaatgatactcctgaggaaatacttctgcgcataggcaatgggaggttctct
ttgagtggtggaatctgggataatatttcacgtggagcaaaggatttgctttctcatatg
cttcacatggacccacatcagcgttatactgctgaacaagtattaaagcacccttggata
acccaaagagaacaactgccgcgtcatcagccaacctcagatgacccgccacaggaagca
gtggctgcagcatattctgttttggctcggaaccagaacaggcatccaatcctggagcct
gttgctgcttcacgtttagctcagagacgtaacatgaaaaagcgaacatcaactggctta
tga

KEGG   Rattus norvegicus (rat): 501560
Entry
501560            CDS       T01003                                 

Gene name
Rps6ka3
Definition
(RefSeq) ribosomal protein S6 kinase alpha-3
  KO
K04373  ribosomal protein S6 kinase alpha-1/2/3/6 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04114  Oocyte meiosis
rno04150  mTOR signaling pathway
rno04714  Thermogenesis
rno04720  Long-term potentiation
rno04722  Neurotrophin signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04931  Insulin resistance
rno05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    501560 (Rps6ka3)
   04150 mTOR signaling pathway
    501560 (Rps6ka3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    501560 (Rps6ka3)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    501560 (Rps6ka3)
  09156 Nervous system
   04720 Long-term potentiation
    501560 (Rps6ka3)
   04722 Neurotrophin signaling pathway
    501560 (Rps6ka3)
  09159 Environmental adaptation
   04714 Thermogenesis
    501560 (Rps6ka3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    501560 (Rps6ka3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    501560 (Rps6ka3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    501560 (Rps6ka3)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    501560 (Rps6ka3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     501560 (Rps6ka3)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   501560 (Rps6ka3)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     501560 (Rps6ka3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo ABC1 Pkinase_fungal Pkinase_C APH Haspin_kinase TCAD9 YrbL-PhoP_reg tRNA-synt_1f
Other DBs
NCBI-GeneID: 501560
NCBI-ProteinID: NP_001178933
RGD: 1563860
Ensembl: ENSRNOG00000006632
UniProt: D3Z8E0
Position
X
AA seq 740 aa
MPLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEGSIKEIAITHHVKEGH
EKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKVRDRVRTKMERD
ILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALA
LDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKESIDHEKKAYSFCGTVEYMAPEVV
NRRGHTQSADWWSFGVLMFEMLTGTLPFQGKDRKETMTMILKAKLGMPQFLSPEAQSLLR
MLFKRNPANRLGAGPDGVEEIKRHSFFSTIDWNKLYRREIHPPFKPATGRPEDTFYFDPE
FTAKTPKDSPGIPPSANAHQLFRGFSFVAITSDDESQAMQTVGVHSIVQQLHRNSIQFTD
GYEVKEDIGVGSYSVCKRCIHKATNMEFAVKIIDKSKRDPTEEIEILLRYGQHPNIITLK
DVYDDGKYVYVVTELMKGGELLDKILRQKFFSEREASAVLFTITKTVEYLHTQGVVHRDL
KPSNILYVDESGNPESIRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDAACD
IWSLGVLLYTMLTGYTPFANGPDDTPEEILARIGSGKFSLSGGYWNSVSDTAKDLVSKML
HVDPHQRLTAALVLRHPWIVHWDQLPQYQLNRQDAPHLVKGAMAATYSALNRNQSPVLEP
VGRSTLAQRRGIKKITSTAL
NT seq 2223 nt   +upstreamnt  +downstreamnt
atgccgctggcgcagctggcggacccgtggcagaagatggctgtggagagcccttccgac
agcgctgagaatggacagcaaattatggatgaacctatgggagaggaggagattaatcca
caaactgaagaaggcagtatcaaagaaattgcaatcacacatcatgtgaaggaaggacat
gaaaaggcagatccttcccagtttgagcttttaaaagtattagggcagggatcttttgga
aaggttttcttagttaaaaaaatctcaggctctgatgctagacaactttatgccatgaag
gtattaaagaaggccacactgaaagttcgagaccgtgttcggacaaaaatggaacgtgat
atcttggtagaagtcaatcatcctttcattgtcaaattgcattatgcttttcaaactgaa
gggaagttgtatcttattttggattttctcaggggaggagatttgtttacacgcttatcc
aaagaggtgatgttcacagaggaagatgtcaaattctacttggctgaacttgcacttgct
ttagaccatctgcatagcctgggaataatctatagagacttaaaaccagaaaacatactt
cttgatgaagaaggtcacatcaagttaactgattttggcttaagtaaggaatctattgac
cacgagaagaaggcatattccttttgtggcactgtggaatacatggctccagaagtagtt
aatcgtagaggtcatactcaaagtgctgactggtggtcttttggtgtgttgatgtttgaa
atgctcactggtacactacctttccaaggaaaagatcgtaaagaaacaatgactatgatt
cttaaagccaaactcgggatgccacagtttctgagtcctgaagcccagagtcttttacga
atgcttttcaaacggaatcctgcaaacagattaggtgccggaccagatggagttgaagaa
attaaaagacattcatttttctcaacaatagactggaataaactatacagaagagagatt
cacccaccttttaagcctgcaactggcagacctgaagatacattttattttgatcctgag
tttactgcaaaaactcccaaagattcacctggcattccacctagtgctaacgcacatcag
ctttttcgggggtttagttttgttgctattacctcagatgacgaaagccaagctatgcag
acagttggtgtgcattcaattgttcagcaattacacaggaacagtattcagtttactgat
ggatatgaagtaaaagaggatattggtgttggctcatactccgtttgtaagagatgtata
cataaagccacaaacatggagtttgccgtgaagattattgataaaagcaagagagaccca
acagaagaaattgaaattcttcttcgttacggacagcatccaaacatcattaccctaaaa
gatgtgtatgatgatggaaaatacgtatacgtagtaacagaacttatgaaaggaggtgaa
ttgctggataaaattcttagacagaagtttttctcagagcgagaggccagtgctgtcctg
tttactataaccaaaactgttgagtatcttcacacacaaggggtggttcacagagactta
aaacctagcaacattctttatgtggatgagtctggtaatccagaatctattcgaatttgt
gactttggctttgcaaaacaactgagagcagaaaatggtcttcttatgactccttgctat
actgcaaattttgttgcaccagaggttttaaaacgacaaggttatgatgctgcctgtgat
atatggagtcttggtgtcctcctttatacaatgcttactggttacactccatttgcaaat
ggtcctgatgatactccagaggaaatactggcacgaataggtagtggaaaattctcactc
agtggtggttactggaattctgtttcagacacagcaaaggacctggtgtcaaagatgctt
catgtagatcctcatcagagactgactgctgctcttgtgctcagacatccttggattgtc
cactgggaccaactgccacaataccaactaaacagacaggatgcaccgcatctcgtaaag
ggtgccatggcagctacatactctgctttaaaccgcaatcagtctccagttttggaaccg
gtaggccgttctactcttgctcagcggagaggtattaaaaaaatcacctcaacagccctg
tga

KEGG   Rattus norvegicus (rat): 81771
Entry
81771             CDS       T01003                                 

Gene name
Rps6ka1
Definition
(RefSeq) ribosomal protein S6 kinase alpha-1
  KO
K04373  ribosomal protein S6 kinase alpha-1/2/3/6 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04114  Oocyte meiosis
rno04150  mTOR signaling pathway
rno04714  Thermogenesis
rno04720  Long-term potentiation
rno04722  Neurotrophin signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04931  Insulin resistance
rno05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    81771 (Rps6ka1)
   04150 mTOR signaling pathway
    81771 (Rps6ka1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    81771 (Rps6ka1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    81771 (Rps6ka1)
  09156 Nervous system
   04720 Long-term potentiation
    81771 (Rps6ka1)
   04722 Neurotrophin signaling pathway
    81771 (Rps6ka1)
  09159 Environmental adaptation
   04714 Thermogenesis
    81771 (Rps6ka1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    81771 (Rps6ka1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    81771 (Rps6ka1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    81771 (Rps6ka1)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    81771 (Rps6ka1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     81771 (Rps6ka1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   81771 (Rps6ka1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     81771 (Rps6ka1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like ABC1 Kdo Pkinase_fungal Pkinase_C APH TCAD9 Haspin_kinase YrbL-PhoP_reg
Other DBs
NCBI-GeneID: 81771
NCBI-ProteinID: NP_112369
RGD: 620675
Ensembl: ENSRNOG00000042411
UniProt: Q63531
Position
5
AA seq 735 aa
MPLAQLKEPWPLMELVPLDPENGQASGEEAGLQPSKDEGILKEISITHHVKAGSEKADPS
HFELLKVLGQGSFGKVFLVRKVTRPDNGHLYAMKVLKKATLKVRDRVRTKMERDILADVN
HPFVVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALGLDHLHS
LGIIYRDLKPENILLDEEGHIKLTDFGLSKEAIDHEKKAYSFCGTVEYMAPEVVNRQGHT
HSADWWSYGVLMFEMLTGSLPFQGKDRKETMTLILKAKLGMPQFLSTEAQSLLRALFKRN
PANRLGSGPDGAEEIKRHIFYSTIDWNKLYRREIKPPFKPAVAQPDDTFYFDTEFTSRTP
RDSPGIPPSAGAHQLFRGFSFVATGLMEDDSKPRATQAPLHSVVQQLHGKNLVFSDGYIV
KETIGVGSYSVCKRCVHKATNMEYAVKVIDKSKRDPSEEIEILLRYGQHPNIITLKDVYD
DSKHVYLVTELMRGGELLDKILRQKFFSEREASFVLYTISKTVEYLHSQGVVHRDLKPSN
ILYVDESGNPECLRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDEGCDIWSL
GVLLYTMLAGYTPFANGPSDTPEEILTRISSGKFTLNGGNWNTVSETAKDLVSKMLHVDP
HQRLTAKQVLQHPWITQKDKLPQSQLSHQDLQLVKGAMAATYSALSSSKPTPQLKPIESS
ILAQRRVRKLPSTTL
NT seq 2208 nt   +upstreamnt  +downstreamnt
atgccgctcgcccagctcaaggaaccctggccgctcatggagctggtgccgctggacccg
gagaatggacaggcttcaggggaagaagctggacttcagccatccaaggatgagggcatc
ctcaaggagatctctatcacacaccacgtcaaggctggctctgagaaggctgatccatcc
cattttgagctcctcaaggttctgggccaaggatcctttggcaaagtcttcctggtacgc
aaggtcacccggcctgacaatgggcacttgtatgccatgaaagtattaaagaaggccacg
ctgaaagtgcgtgaccgtgttcggaccaagatggagagagacatcctagctgacgtgaac
caccccttcgtagtgaaactgcactatgccttccagaccgagggcaagctctatcttatt
ctggactttctgcgtggtggagacctgttcacacgactctcaaaggaggttatgtttaca
gaggaggatgtgaagttttacctggctgagctggcactgggcctggaccacctgcacagc
ttgggcatcatttacagagacctcaagcctgagaatatccttttggatgaggagggccac
atcaaactcactgactttggcctgagcaaggaggccattgaccacgaaaagaaggcctat
tccttctgcgggacggtggagtacatggcccccgaggttgtcaaccgccagggccacacc
cacagtgcagattggtggtcctatggggtgttgatgtttgagatgctgacgggctccctg
cccttccaggggaaggaccggaaggagaccatgaccttgattttgaaggcaaagctaggc
atgccccagtttctgagcacggaagcccagagcctcctgcgggccctgttcaagaggaat
cctgccaaccggcttggctcaggccccgatggggctgaggaaattaagagacatatcttc
tactctaccattgactggaataagctctaccgccgtgagatcaagccacctttcaagccc
gctgtggcccagccggatgacaccttctactttgataccgagttcacgtcacgcacaccc
agggattcgccgggcatcccccccagtgctggtgcccatcagctcttccgtggcttcagc
ttcgtggccaccggtctgatggaggatgacagcaagcctcgggccacccaggctccgctg
cactcggtggtacagcaactccacgggaagaacttggttttcagcgatggctacatagta
aaggagacgatcggcgtgggctcctactctgtgtgtaagcgctgtgtccacaaggccacc
aacatggagtacgcagtcaaagtcatcgacaaaagcaaaagagatccctccgaagagatc
gagattcttctgcggtatggacagcaccccaacatcatcaccctgaaagatgtgtatgac
gacagtaagcacgtatacctggtgacagagctgatgaggggcggggagctgctggataag
atcctacggcagaaattcttctcagagcgggaggccagcttcgtcctgtacaccatcagc
aagactgtggaatacttgcactcccaaggggtcgtccacagggacctcaaacccagtaac
atcctgtatgtggatgagtctgggaaccccgaatgcctacgaatatgcgactttggcttt
gccaagcagctacgggctgagaacgggcttctcatgacaccttgctacacagccaacttt
gtggcacctgaggtgctgaagcgtcagggctacgatgaaggctgtgacatatggagcctg
ggcgttctgctgtacacgatgctggcaggatacactccatttgccaatgggcccagtgat
accccagaggagatcctcacccggatcagcagtgggaagttcaccctcaacgggggaaac
tggaacacggtttcagagacagccaaggacttagtatctaagatgctgcatgtggacccc
caccagcgcctcacagccaaacaggttctgcagcacccgtggatcacccagaaagacaag
ctcccccagagccagttgtcccaccaagacctgcagcttgtgaagggggccatggcagct
acatattctgcactcagtagctccaaacccaccccccagctcaagccaatcgagtcgtcc
atcctggcccagcggcgggtgaggaagctgccatccaccaccctgtga

DBGET integrated database retrieval system