KEGG   Rattus norvegicus (rat): 117270Help
Entry
117270            CDS       T01003                                 

Gene name
Tff1, Ps2
Definition
(RefSeq) trefoil factor 1
  KO
K22456  trefoil factor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04915  Estrogen signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    117270 (Tff1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trefoil TEX29
Motif
Other DBs
NCBI-GeneID: 117270
NCBI-ProteinID: NP_476470
RGD: 620707
Ensembl: ENSRNOG00000001164
UniProt: Q63467
Position
20p12
AA seq 81 aa AA seqDB search
MEHKVTCVLAMVLMLALSSLAQNQEETCAVIPRERINCGFPGVTAQQCKEKGCCFDDSVR
GFPWCFRPLVIENQQEEECPF
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atggagcacaaggtgacctgtgtcctcgccatggtcctcatgctggctctcagcagcctt
gcccagaaccaggaagaaacatgtgccgtgatcccccgggagagaataaattgtggcttc
cccggtgtcaccgcccagcagtgcaaggaaaagggttgctgttttgatgacagtgtccgg
gggttcccatggtgcttccgacctctggtcattgagaaccagcaagaagaagaatgtccc
ttctaa

DBGET integrated database retrieval system