KEGG   Rattus norvegicus (rat): 117273
Entry
117273            CDS       T01003                                 

Gene name
Rhoa
Definition
(RefSeq) transforming protein RhoA
  KO
K04513  Ras homolog gene family, member A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04144  Endocytosis
rno04150  mTOR signaling pathway
rno04270  Vascular smooth muscle contraction
rno04310  Wnt signaling pathway
rno04350  TGF-beta signaling pathway
rno04360  Axon guidance
rno04510  Focal adhesion
rno04520  Adherens junction
rno04530  Tight junction
rno04611  Platelet activation
rno04621  NOD-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04660  T cell receptor signaling pathway
rno04670  Leukocyte transendothelial migration
rno04722  Neurotrophin signaling pathway
rno04810  Regulation of actin cytoskeleton
rno04921  Oxytocin signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno04972  Pancreatic secretion
rno05100  Bacterial invasion of epithelial cells
rno05132  Salmonella infection
rno05133  Pertussis
rno05135  Yersinia infection
rno05152  Tuberculosis
rno05163  Human cytomegalovirus infection
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05210  Colorectal cancer
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    117273 (Rhoa)
   04015 Rap1 signaling pathway
    117273 (Rhoa)
   04310 Wnt signaling pathway
    117273 (Rhoa)
   04350 TGF-beta signaling pathway
    117273 (Rhoa)
   04072 Phospholipase D signaling pathway
    117273 (Rhoa)
   04071 Sphingolipid signaling pathway
    117273 (Rhoa)
   04024 cAMP signaling pathway
    117273 (Rhoa)
   04022 cGMP-PKG signaling pathway
    117273 (Rhoa)
   04150 mTOR signaling pathway
    117273 (Rhoa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    117273 (Rhoa)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    117273 (Rhoa)
   04520 Adherens junction
    117273 (Rhoa)
   04530 Tight junction
    117273 (Rhoa)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    117273 (Rhoa)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    117273 (Rhoa)
   04621 NOD-like receptor signaling pathway
    117273 (Rhoa)
   04625 C-type lectin receptor signaling pathway
    117273 (Rhoa)
   04660 T cell receptor signaling pathway
    117273 (Rhoa)
   04670 Leukocyte transendothelial migration
    117273 (Rhoa)
   04062 Chemokine signaling pathway
    117273 (Rhoa)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    117273 (Rhoa)
   04928 Parathyroid hormone synthesis, secretion and action
    117273 (Rhoa)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    117273 (Rhoa)
  09154 Digestive system
   04972 Pancreatic secretion
    117273 (Rhoa)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    117273 (Rhoa)
  09158 Development and regeneration
   04360 Axon guidance
    117273 (Rhoa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    117273 (Rhoa)
   05206 MicroRNAs in cancer
    117273 (Rhoa)
   05205 Proteoglycans in cancer
    117273 (Rhoa)
   05203 Viral carcinogenesis
    117273 (Rhoa)
  09162 Cancer: specific types
   05210 Colorectal cancer
    117273 (Rhoa)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    117273 (Rhoa)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    117273 (Rhoa)
   05135 Yersinia infection
    117273 (Rhoa)
   05133 Pertussis
    117273 (Rhoa)
   05152 Tuberculosis
    117273 (Rhoa)
   05100 Bacterial invasion of epithelial cells
    117273 (Rhoa)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    117273 (Rhoa)
   05418 Fluid shear stress and atherosclerosis
    117273 (Rhoa)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    117273 (Rhoa)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    117273 (Rhoa)
   04031 GTP-binding proteins [BR:rno04031]
    117273 (Rhoa)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    117273 (Rhoa)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   117273 (Rhoa)
  Exosomal proteins of other body fluids (saliva and urine)
   117273 (Rhoa)
  Exosomal proteins of colorectal cancer cells
   117273 (Rhoa)
  Exosomal proteins of bladder cancer cells
   117273 (Rhoa)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    117273 (Rhoa)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA VASP_tetra
Other DBs
NCBI-GeneID: 117273
NCBI-ProteinID: NP_476473
RGD: 619921
Ensembl: ENSRNOG00000050519
UniProt: P61589
Structure
PDB: 
3TVD

Position
8
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLIL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgccatcaggaagaaactggtgattgttggtgatggagcttgtggtaagacatgc
ttgctcatagtcttcagcaaggaccagttcccagaggtttatgtgcccacggtgtttgaa
aactatgtggcagatattgaagtggacgggaagcaggtagagttggctttatgggacaca
gctggacaggaagattatgaccgtctgaggcctctctcctacccagacactgatgttata
ctgatgtgtttttccatcgacagccctgatagtttagaaaacatcccagaaaaatggact
ccagaagtcaagcatttctgtccaaatgtgcccatcatcctagttgggaacaagaaggat
cttcggaatgatgagcacacaaggcgggagttagccaaaatgaagcaggagccggtaaaa
cctgaagaaggcagagatatggcaaacaggattggcgcttttgggtacatggagtgttca
gcaaagaccaaagacggagtgagagaggtttttgagatggccacgagagctgctctgcaa
gctagacgcgggaagaaaaagtcggggtgcctcatcttgtga

KEGG   Rattus norvegicus (rat): 297173
Entry
297173            CDS       T01003                                 

Gene name
RSA-14-44
Definition
(RefSeq) ras homolog gene family, member A
  KO
K04513  Ras homolog gene family, member A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04144  Endocytosis
rno04150  mTOR signaling pathway
rno04270  Vascular smooth muscle contraction
rno04310  Wnt signaling pathway
rno04350  TGF-beta signaling pathway
rno04360  Axon guidance
rno04510  Focal adhesion
rno04520  Adherens junction
rno04530  Tight junction
rno04611  Platelet activation
rno04621  NOD-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04660  T cell receptor signaling pathway
rno04670  Leukocyte transendothelial migration
rno04722  Neurotrophin signaling pathway
rno04810  Regulation of actin cytoskeleton
rno04921  Oxytocin signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno04972  Pancreatic secretion
rno05100  Bacterial invasion of epithelial cells
rno05132  Salmonella infection
rno05133  Pertussis
rno05135  Yersinia infection
rno05152  Tuberculosis
rno05163  Human cytomegalovirus infection
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05210  Colorectal cancer
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    297173 (RSA-14-44)
   04015 Rap1 signaling pathway
    297173 (RSA-14-44)
   04310 Wnt signaling pathway
    297173 (RSA-14-44)
   04350 TGF-beta signaling pathway
    297173 (RSA-14-44)
   04072 Phospholipase D signaling pathway
    297173 (RSA-14-44)
   04071 Sphingolipid signaling pathway
    297173 (RSA-14-44)
   04024 cAMP signaling pathway
    297173 (RSA-14-44)
   04022 cGMP-PKG signaling pathway
    297173 (RSA-14-44)
   04150 mTOR signaling pathway
    297173 (RSA-14-44)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    297173 (RSA-14-44)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    297173 (RSA-14-44)
   04520 Adherens junction
    297173 (RSA-14-44)
   04530 Tight junction
    297173 (RSA-14-44)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    297173 (RSA-14-44)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    297173 (RSA-14-44)
   04621 NOD-like receptor signaling pathway
    297173 (RSA-14-44)
   04625 C-type lectin receptor signaling pathway
    297173 (RSA-14-44)
   04660 T cell receptor signaling pathway
    297173 (RSA-14-44)
   04670 Leukocyte transendothelial migration
    297173 (RSA-14-44)
   04062 Chemokine signaling pathway
    297173 (RSA-14-44)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    297173 (RSA-14-44)
   04928 Parathyroid hormone synthesis, secretion and action
    297173 (RSA-14-44)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    297173 (RSA-14-44)
  09154 Digestive system
   04972 Pancreatic secretion
    297173 (RSA-14-44)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    297173 (RSA-14-44)
  09158 Development and regeneration
   04360 Axon guidance
    297173 (RSA-14-44)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    297173 (RSA-14-44)
   05206 MicroRNAs in cancer
    297173 (RSA-14-44)
   05205 Proteoglycans in cancer
    297173 (RSA-14-44)
   05203 Viral carcinogenesis
    297173 (RSA-14-44)
  09162 Cancer: specific types
   05210 Colorectal cancer
    297173 (RSA-14-44)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    297173 (RSA-14-44)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    297173 (RSA-14-44)
   05135 Yersinia infection
    297173 (RSA-14-44)
   05133 Pertussis
    297173 (RSA-14-44)
   05152 Tuberculosis
    297173 (RSA-14-44)
   05100 Bacterial invasion of epithelial cells
    297173 (RSA-14-44)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    297173 (RSA-14-44)
   05418 Fluid shear stress and atherosclerosis
    297173 (RSA-14-44)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    297173 (RSA-14-44)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    297173 (RSA-14-44)
   04031 GTP-binding proteins [BR:rno04031]
    297173 (RSA-14-44)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    297173 (RSA-14-44)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   297173 (RSA-14-44)
  Exosomal proteins of other body fluids (saliva and urine)
   297173 (RSA-14-44)
  Exosomal proteins of colorectal cancer cells
   297173 (RSA-14-44)
  Exosomal proteins of bladder cancer cells
   297173 (RSA-14-44)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    297173 (RSA-14-44)
SSDB
Motif
Pfam: Ras Roc Arf SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 297173
NCBI-ProteinID: NP_872611
RGD: 735071
Ensembl: ENSRNOG00000042954
UniProt: Q5XIM3
Position
4
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPDVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVLLICFSIGNPDSFGNIPHKWIPEVKHFCPNVPIILVGSKKD
LRNDLNTIQELAKRKQEPVKPEQGRDLANSIGAFEYVECSAKTKDGVRKVFEKATRAALQ
TNRVKKKTGCFVF
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgccatccggaagaaactggtgattgtgggagatggagcttgtggaaaaacatgc
ttgctcatcgtcttcagcaaggaccagtttcctgatgtttatgtgcccacagtgtttgag
aactatgtggctgatatcgaagtggatggaaaacaggtggagttggccctctgggacaca
gctggtcaagaagattatgatcgcttgaggccactctcctatccggacactgatgtcctc
ttgatatgtttctccattggcaaccctgatagctttgggaacatcccacacaaatggata
ccagaagtaaagcatttctgtcccaacgtgcccatcatcctggtcgggagcaagaaggat
cttcggaatgacttgaacacaatacaagagttagccaagaggaaacaagagccggtgaaa
cctgaacaaggccgagatttggcgaacagcattggcgctttcgagtatgtggagtgttct
gcaaagaccaaagatggagtgagaaaggtctttgaaaaagccaccagggctgctctgcaa
acgaaccgtgtgaagaaaaagactggctgctttgtcttttga

DBGET integrated database retrieval system