KEGG   Rattus norvegicus (rat): 117274Help
Entry
117274            CDS       T01003                                 

Gene name
Nr0b2, Shp
Definition
(RefSeq) nuclear receptor subfamily 0, group B, member 2
  KO
K08563  nuclear receptor subfamily 0 group B member 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    117274 (Nr0b2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    117274 (Nr0b2)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rno03310]
    117274 (Nr0b2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys4 Knirps/DAX 1-like
    117274 (Nr0b2)
Nuclear receptors [BR:rno03310]
 0. Knirps / DAX like
  0B. DAX like receptor
   117274 (Nr0b2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep
Motif
Other DBs
NCBI-GeneID: 117274
NCBI-ProteinID: NP_476474
RGD: 621032
Ensembl: ENSRNOG00000007229
UniProt: P97947
Position
5q36
AA seq 260 aa AA seqDB search
MSSSQSGVCPCQGSASHPTILYTLLSPGPRTRPMAPASRSHCLCQQHRPVRLCAPHRTCR
EALDVLGKTVAFLRNLPSFCLLPHEDQRRLLEGCWGPLFLLGLAQDTVTFEVAEAPVPSI
LKKILLEEPNSGAQGAQPPDPPQPSLAAVQWLQHCLESFWSLELGPKEYAYLKGTILFNP
DVPGLHASCHIAHLQQEAHWALCEVLEPWYPASQGRLARILLMASTLKNISCTLLVDLFF
RPVIGDVDITELLEDMLLLR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagctccagccaatcaggggtctgcccatgccagggctctgcaagccaccccaccatt
ctctacacacttctaagccccggtcccaggaccaggcccatggcacccgcatctcgcagc
cactgcctgtgccagcaacaccggcctgtgcgcctgtgtgctccacaccgcacctgcagg
gaggccttggatgtcctaggcaagactgtagccttcctcaggaacctgccgtccttctgc
ctcctgccccatgaggatcagcgacggctgctagagggctgctggggccctctcttcctg
cttgggttggcccaggatactgtgacctttgaggtggccgaggctccggtccccagcata
cttaaaaagatcttgctagaggaacccaacagtggtgcccagggtgcccagccaccagac
ccaccacaaccctcactggctgccgtgcagtggctgcagcactgcctggagtctttctgg
agccttgagctgggtcccaaggagtacgcatacctgaaaggcactatcctcttcaaccca
gatgtgccaggcctccatgcctcctgccacattgcacacctgcaacaggaggctcactgg
gcattgtgtgaagtcctggagccctggtacccagctagccaaggccgcctggcccgaatc
ctcctcatggcttccaccctcaagaacatctcctgtacccttctggtagatctcttcttc
cgccctgtcatcggagatgttgacatcactgaactgcttgaagacatgcttttgttgagg
tga

DBGET integrated database retrieval system