KEGG   Rattus norvegicus (rat): 117275
Entry
117275            CDS       T01003                                 

Gene name
Chrd
Definition
(RefSeq) chordin
  KO
K04657  chordin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    117275 (Chrd)
SSDB
Motif
Pfam: CHRD VWC
Other DBs
NCBI-GeneID: 117275
NCBI-ProteinID: NP_476475
RGD: 620181
Ensembl: ENSRNOG00000001750
UniProt: A0A140TA94
Position
11q23
AA seq 948 aa
MPSLPAPPAPRLLLGLLLLGSRPAGGTGPEAPALPIRSEKEPLPVRGAAGCSFGGKVYAL
DETWHPDLGEPFGVMRCVLCACEAPQWARRGRGPGRVSCKNIKPQCPTLACRQPRQLPGH
CCQTCPQERSNLDPQPAGLVFEYPRDPEHRSYSDRGEPGTGERTRGDGHTDFVALLTGPR
TQAVARARVSLLRSSLRFSISYQRLDRPSRVRFTDPTGNILFEHPAAPTQDGLVCGVWRA
VPRLSVRLLRAEQLRVALVTPTHPSEEVWGPLIWQGALTAETFSAILTLEDPLQRGVGGI
ALLTLSDTEDALHFLLLFRGLLGGLAHVPLKLQILHQGQLLRELQANASAQEPGFAEVLP
SLTDQEMDWLVLGELQMVLEKMGGPELRISGYITTRQSCDVLQSVLCGADALIPVQTGAA
GSASFILLGNGSLIYQVQVIGTGSEVVAMTLETKPQRKNQRTVLCHMAGLQLGGHMAVGV
CSGLGARGAHMLLQNELFLNIGTKDFPDGELRGHVTALCYSGHSAHYDRLPVPLAGALVL
PPVRSQAAGHAWLSLDTHCHLHYEVLLAGLGGSEQGTVTAHLLGPPGMPGPQRLLKGFYG
SEAQGVVKDLEPVLLRHLTQGTASLLITTKSNPRGELRGQVHIASQCEVGGLRLASEGVR
MSLAPNGEAATSPMLPAGPGPEAPVPAKHGSSGRPRDPNTCFFEGQQRPHGARWAPNYDP
LCSLCTCQRRTVICDPVVCPPPSCPHPVQALDQCCPVCPEKQRSRDLPSLPNLEPGEGCY
FDGDRSWRAAGTRWHPVVPPFGLIKCAVCTCKGATGEVHCEKVQCPRLACAQPVRANPTD
CCKQCPVGSGTHAKLGDPMQADGPRGCRFAGQWFPENQSWHPSVPPFGEMSCITCRCGAG
VPHCERDDCSPPLSCGSGKESRCCSHCTAQRSSETRTLPELEKEAQRS
NT seq 2847 nt   +upstreamnt  +downstreamnt
atgccgagcctcccggccccgccggcccctcggctgctcctcgggctgctgctgctcggc
tcgcggccggccggtggcactggccctgaggcccccgcactgcccatccgttccgagaag
gagccactgcctgtccggggagcggcaggctgctccttcggcgggaaggtctatgccttg
gacgagacgtggcacccggacctgggggagccttttggggtgatgcgctgtgtgctgtgc
gcctgcgaagcgcctcagtgggctcgccgtgggaggggccctggcagggtcagctgcaag
aacatcaaacctcagtgccccaccctggcctgcaggcagccgcgccagctgccaggacac
tgctgccagacctgcccgcaggagcgcagcaatctagatccacagccggctggcctggtc
ttcgagtatccaagggacccagagcatcgcagttatagcgatcgaggggaacccggcact
ggggagcggacacgtggtgatggccacacggactttgtggcgttgctgactggaccgagg
acgcaggcggtagctcgtgctcgagtctctttgctgcgctcaagtttacgcttctctatc
tcctaccagcggctggaccgtcccagcagggttcggttcacagaccccacaggcaacatc
ctgtttgaacaccctgctgcccccacccaagatggcctggtctgtggggtgtggcgggca
gtgcctcggctgtctgtgaggctcctgagggcagagcagctgcgtgttgcccttgtgaca
cccactcacccttcagaagaagtctgggggcctctcatttggcagggtgctctcactgca
gagaccttcagtgccatcctgaccctggaggacccactgcagcggggtgtcgggggcata
gccctgctcactctcagtgacacagaagatgccttacattttttgctgctcttccggggt
ctgctgggaggactagctcacgtccccttgaagcttcagattctccaccagggacagcta
cttcgagagctccaggccaatgcctcagctcaggagccaggttttgctgaggtgctgccc
agccttacagaccaagagatggactggttggtgctgggggagctgcagatggtcctagag
aagatgggtgggccagagctacgcatcagcgggtatatcacgaccaggcagagctgtgat
gtccttcaaagcgtcctctgtggggctgatgccttgatcccagtccagacgggtgctgct
ggctcagccagcttcatactgctaggaaatggctcccttatctatcaggtacaagtgata
ggtacaggtagcgaggtggtggccatgacgctggagaccaagcctcagcggaagaaccag
cgcactgtcctgtgccacatggctggactccagctgggaggacacatggctgtgggtgtc
tgctctgggctgggtgcccgaggggctcacatgctgctacagaatgagttgttcctgaat
attggtaccaaggacttcccagacggagagcttcgggggcacgtgactgccctatgctac
agcgggcacagtgcccactacgacagattgcctgtgcctctggcaggggcactagtactg
ccccctgtgcggagtcaggcagcaggacatgcctggctgtccttggatacacattgccac
ttacactatgaggttctattggctgggcttggtggctcagagcaaggaactgtcactgct
catctcctcgggcctcctgggatgccagggccccagcgactgctgaagggattctatggc
tcagaggctcagggtgtggtaaaagatctagagcccgtgctgctgcggcacctgacacag
ggcaccgcctccctgcttatcaccaccaagagtaaccctagaggagagctacgcgggcag
gtgcacattgccagtcagtgtgaggtgggaggcctgcgcctggcctcagaaggagtgcgg
atgtccttggctccaaatggagaggcagctacatcacccatgctgcctgctgggcccggc
cctgaagcccccgtaccagccaaacacggcagctctgggagaccccgagatcctaacaca
tgtttcttcgaggggcagcagcgtccccacggggctcgctgggcacccaactatgaccca
ctctgctccctctgcacctgccagagacggacagtgatctgtgatcctgtagtatgccca
ccaccaagctgtccccacccggtgcaggcactggaccagtgctgtcccgtgtgtccagag
aaacaacgcagtagagaccttcccagcctaccaaatctggagccaggagagggctgctat
tttgatggtgaccggagctggagggcagcgggtacccgatggcaccccgttgtgcccccc
tttggcctaattaagtgtgctgtctgcacctgcaagggggccaccggagaggtgcactgt
gagaaggtgcagtgtcctcgcctcgcctgtgctcagcctgtccgtgccaaccccaccgac
tgctgcaaacagtgcccagtagggtcagggactcatgccaagctgggagaccccatgcag
gctgatgggcctcggggttgtcgctttgctgggcagtggttcccagagaatcagagctgg
cacccatcagtgcccccctttggggagatgagctgtattacctgcagatgtggggcaggg
gtaccccactgtgagcgggacgattgctcgccgccactatcctgcggctcagggaaggag
agtcgatgctgttcccactgtacagcccaaaggtcctctgagactagaacccttcccgag
ctggagaaagaagctcaacgctcctag

DBGET integrated database retrieval system