KEGG   Rattus norvegicus (rat): 117277Help
Entry
117277            CDS       T01003                                 

Gene name
Epn1
Definition
(RefSeq) Epsin 1
  KO
K12471  epsin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    117277 (Epn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    117277 (Epn1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    117277 (Epn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ENTH ANTH UIM VHS
Motif
Other DBs
NCBI-GeneID: 117277
NCBI-ProteinID: NP_476477
RGD: 619772
Ensembl: ENSRNOG00000015753
UniProt: O88339
Structure
PDB: 

Position
1q12
AA seq 575 aa AA seqDB search
MSTSSLRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMI
WKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQG
VNVREKAKQLVALLRDEDRLREERAHALKTKEKLAQTATASSAAVGSGPPPEAEQAWPQS
SGEEELQLQLALAMSKEEADQPPSCGPEDDVQLQLALSLSREEHDKEERIRRGDDLRLQM
AIEESKRETGGKEESSLMDLADVFTTPAPPQASDPWGGPASVPTAVPVAAAASDPWGAPA
VPPAADPWGGAAPTPASGDPWRPAAPTGPSVDPWGGTPAPAAGEGPTSDPWGSADGGAPV
SGPPSSDPWAPAPAFSDPWGGSPAKPSSNGTAVGGFDTEPDEFSDFDRLRTALPTSGSST
GELELLAGEVPARSPGAFDMSGVGGSLAESVGSPPPAATPTPTPPTRKTPESFLGPNAAL
VDLDSLVSRPGPTPPGAKASNPFLPSGAPATGPSVTNPFQPAPPATLTLNQLRLSPVPPV
PGAPPTYISPLGGGPGLPPMMPPGPPAPNTNPFLL
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacatcatcgctgcggcgtcagatgaagaatatcgtccacaactactcagaggca
gagatcaaggtccgggaggccacaagcaatgatccctggggcccatccagctccctcatg
tcagagattgctgacctcacctacaatgttgtggccttctccgagattatgagcatgatc
tggaagcggctcaacgaccatggcaagaattggaggcacgtctacaaggccatgacgttg
atggagtacctcatcaagactggctctgagcgtgtatcacaacagtgcaaagagaacatg
tatgctgtgcagacgctgaaggacttccaatatgtggaccgtgatggcaaggaccagggt
gtgaatgtgcgggagaaggccaagcagctggtggctttgctgcgtgatgaggatcggctt
cgggaggagcgcgcccacgcgctcaagaccaaggagaaactggcacagactgccacggct
tcctcagcagctgtgggctctggaccacctcccgaggcggagcaggcatggccacagagc
agcggggaggaggagttgcagctccagctggccctggctatgagcaaggaggaggctgac
cagcccccgtcctgcggccccgaggatgacgtccagctccagctggcccttagtttgagc
cgagaggagcacgataaggaagagcggatccgtcgtggggatgacctgaggctgcagatg
gcaatagaggagagcaagagggagactgggggcaaggaggagtcatctcttatggatctt
gctgacgtcttcacaaccccagcccctccacaggcctcagacccttgggggggcccggca
tctgtgcctactgctgtccctgtggctgctgctgcctcagacccttggggggcacctgct
gtccctccagctgctgatccttggggtggtgcagcccccacgccagcctccggggatcct
tggaggcctgcagcccctacagggccctctgttgacccttggggtgggaccccagctcct
gcagctggagaggggcccacatctgacccgtggggaagcgctgatggtggggcccctgtc
agtggacccccatcttctgacccctgggcacctgccccagctttctcagacccttgggga
ggttcacctgcaaagcccagcagcaatggcactgcagttgggggctttgacactgagccc
gatgagttctcagacttcgaccgactccgcactgccctgccaacctctgggagcagcaca
ggggaattggagttgctcgcaggggaggttcctgctcgcagccccggggcattcgacatg
agtggggttgggggatctctggctgagtctgtggggagtccccctcctgcggcaacccca
actcctaccccgccaacacggaagactccggagtcattcctaggccctaatgcagccctt
gtggacttggactcactggtgagccgaccaggccctacaccgccaggagccaaggcttcc
aacccattccttccaagtggagctccggccaccggcccctccgtcaccaatcctttccag
ccagcaccccctgcaacgctcaccctgaaccagctccgtctcagtcctgtgcccccagtt
cctggagcgccacccacctacatctctcctcttggtggaggccctggcctgccccccatg
atgcccccgggtcccccagcccccaacactaaccccttcctcctataa

DBGET integrated database retrieval system