KEGG   Rattus norvegicus (rat): 117279Help
Entry
117279            CDS       T01003                                 

Gene name
Cflar, Flip
Definition
(RefSeq) CASP8 and FADD-like apoptosis regulator
  KO
K04724  CASP8 and FADD-like apoptosis regulator
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04064  NF-kappa B signaling pathway
rno04140  Autophagy - animal
rno04210  Apoptosis
rno04217  Necroptosis
rno04668  TNF signaling pathway
rno05142  Chagas disease (American trypanosomiasis)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    117279 (Cflar)
   04668 TNF signaling pathway
    117279 (Cflar)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    117279 (Cflar)
  09143 Cell growth and death
   04210 Apoptosis
    117279 (Cflar)
   04217 Necroptosis
    117279 (Cflar)
 09160 Human Diseases
  09167 Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    117279 (Cflar)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rno01002]
    117279 (Cflar)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C14: caspase family
   117279 (Cflar)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DED NAD_binding_6 HTH_20
Motif
Other DBs
NCBI-GeneID: 117279
NCBI-ProteinID: NP_476479
RGD: 620847
Ensembl: ENSRNOG00000012473
UniProt: C0H5Y5 Q99MZ5
Position
9q31
AA seq 218 aa AA seqDB search
MALSTVSAEVIHQVEESLDEDEKEMMLFLCRDVTENLAPPNVRDLLDCLSERGQLSFAAL
AELLYRVRRFDLLKRILKTDKAAVEDHLCRSPHLVSDYRVLLMEIGENLNQSDVSSLIFL
TKDYTGRGKVAKDKSFLDLVIELEKLNLIGSDQLNLLEKCLKSIHRIDLKTKIQKYTQSS
QEARSNMNALQASLPKLSIKEHLYNSRVSLEPVCGISA
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggccctgagcactgtgtctgctgaggtcattcaccaggtggaggagtctcttgatgag
gatgagaaggagatgatgctcttcttgtgtagagatgtgactgagaacctggctccaccc
aacgtcagggacctcctggattgtttaagtgagagaggccagctctccttcgctgcctta
gctgagctgctgtacagggtgcggcggtttgacctgctcaagaggattttgaagacagat
aaagcagcggtggaggaccatctgtgcagaagccctcaccttgtttccgattatagggtg
ctgctgatggagattggggagaatttgaatcaatctgatgtatcctccttaattttcctt
acaaaggattacacaggccgaggcaaggtagccaaggacaagagtttcttggacctggtg
attgaactggagaaactgaatttgattggttccgatcagttgaatttattagaaaaatgc
ctgaagagcatccacagaatagacttgaagacaaaaatccagaagtacacgcagtccagc
caagaagcaagatcaaatatgaatgctctccaggcttctctcccaaaattgagtatcaag
gaacatttatataactcaagggtgagtctggagccagtgtgtggaatatcagcatga

DBGET integrated database retrieval system