KEGG   Rattus norvegicus (rat): 117279Help
Entry
117279            CDS       T01003                                 

Gene name
Cflar, Flip
Definition
(RefSeq) CASP8 and FADD-like apoptosis regulator
  KO
K04724  CASP8 and FADD-like apoptosis regulator
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04064  NF-kappa B signaling pathway
rno04140  Autophagy - animal
rno04210  Apoptosis
rno04217  Necroptosis
rno04668  TNF signaling pathway
rno05142  Chagas disease (American trypanosomiasis)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    117279 (Cflar)
   04668 TNF signaling pathway
    117279 (Cflar)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    117279 (Cflar)
  09143 Cell growth and death
   04210 Apoptosis
    117279 (Cflar)
   04217 Necroptosis
    117279 (Cflar)
 09160 Human Diseases
  09174 Infectious diseases: Parasitic
   05142 Chagas disease (American trypanosomiasis)
    117279 (Cflar)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rno01002]
    117279 (Cflar)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C14: caspase family
   117279 (Cflar)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DED NAD_binding_6 HTH_20
Motif
Other DBs
NCBI-GeneID: 117279
NCBI-ProteinID: NP_476479
RGD: 620847
Ensembl: ENSRNOG00000012473
UniProt: C0H5Y5 Q99MZ5
Position
9q31
AA seq 218 aa AA seqDB search
MALSTVSAEVIHQVEESLDEDEKEMMLFLCRDVTENLAPPNVRDLLDCLSERGQLSFAAL
AELLYRVRRFDLLKRILKTDKAAVEDHLCRSPHLVSDYRVLLMEIGENLNQSDVSSLIFL
TKDYTGRGKVAKDKSFLDLVIELEKLNLIGSDQLNLLEKCLKSIHRIDLKTKIQKYTQSS
QEARSNMNALQASLPKLSIKEHLYNSRVSLEPVCGISA
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggccctgagcactgtgtctgctgaggtcattcaccaggtggaggagtctcttgatgag
gatgagaaggagatgatgctcttcttgtgtagagatgtgactgagaacctggctccaccc
aacgtcagggacctcctggattgtttaagtgagagaggccagctctccttcgctgcctta
gctgagctgctgtacagggtgcggcggtttgacctgctcaagaggattttgaagacagat
aaagcagcggtggaggaccatctgtgcagaagccctcaccttgtttccgattatagggtg
ctgctgatggagattggggagaatttgaatcaatctgatgtatcctccttaattttcctt
acaaaggattacacaggccgaggcaaggtagccaaggacaagagtttcttggacctggtg
attgaactggagaaactgaatttgattggttccgatcagttgaatttattagaaaaatgc
ctgaagagcatccacagaatagacttgaagacaaaaatccagaagtacacgcagtccagc
caagaagcaagatcaaatatgaatgctctccaggcttctctcccaaaattgagtatcaag
gaacatttatataactcaagggtgagtctggagccagtgtgtggaatatcagcatga

DBGET integrated database retrieval system