KEGG   Rattus norvegicus (rat): 117280
Entry
117280            CDS       T01003                                 

Gene name
Hnrnpu, Hnrpu, SN1
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein U
  KO
K12888  heterogeneous nuclear ribonucleoprotein U
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    117280 (Hnrnpu)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    117280 (Hnrnpu)
Spliceosome [BR:rno03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    117280 (Hnrnpu)
SSDB
Motif
Pfam: AAA_33 SPRY SAP AAA_18 SRP54 Zeta_toxin
Other DBs
NCBI-GeneID: 117280
NCBI-ProteinID: NP_476480
RGD: 620372
Ensembl: ENSRNOG00000033790
UniProt: Q6IMY8
Position
13q25
AA seq 798 aa
MSSSPVNVKKLKVSELKEELKKRRLSDKGLKADLMDRLQAALDNEAGGRPAMEPGNGSLD
LGGDAAGRSGAGLEQEAAAGAEDDEEEEGIAALDGDQMELGEENGAAGAADAGAMEEEEA
ASEDENGDDQGFQEGEDELGDEEEGAGDENGHGEQQSQPPAAAQQASQQRGPGKEAAGKS
SGPTSLFAVTVAPPGARQGQQQAGGDGKTEQKAGDKKRGVKRPREDHGRGYFEYIEENKY
SRAKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFKISRDRLSASSLTMESFAFLWAGGRAS
YGVSKGKVCFEMKVTEKIPVRHLYTKDIDIHEVRIGWSLTTSGMLLGEEEFSYGYSLKGI
KTCNCETEDYGEKFDENDVITCFANFETDEVELSYAKNGQDLGVAFKISKEVLADRPLFP
HVLCHNCAVEFNFGQKEKPYFPIPEDCTFIQNVPLEDRVRGPKGPEEKKDCEVVMMIGLP
GAGKTTWVTKHAAENPGKYNILGTNTIMDKMMVAGFKKQMADTGKLNTLLQRAPQCLGKF
IEIAARKKRNFILDQTNVSAAAQRRKMCLFAGFQRKAVVVCPKDEDYKQRTQKKAEVEGK
DLPEHAVLKMKGNFTLPEVAECFDEITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTG
SKKSNKNKSGKNQFNRGGGHRGRGGFNMRGGNFRGGAPGNRGGYNRRGNMPQRGGGGGSG
GIGYPYPRGPVFPGRGGYSNRGNYNRGGMPNRGNYNQNFRGRGNNRGYKNQSQGYNQWQQ
GQFWGQKPWSQHYHQGYY
NT seq 2397 nt   +upstreamnt  +downstreamnt
atgagttcttcgcctgttaatgtcaagaagctgaaggtgtcggagctgaaggaggagctc
aagaagcggcgcctctcagacaagggcctcaaggccgatctcatggatcgactccaggcc
gcgctggacaacgaggcaggaggccgccccgccatggagcccgggaacggcagcctcgac
ctgggtggcgatgcggccgggcgctcgggagcaggcctagagcaggaggccgcggccggc
gccgaagacgatgaggaggaggagggcattgccgctctggacggcgaccagatggagctg
ggcgaggagaacggggcggcgggggcggctgacgcgggcgcgatggaggaggaggaggcg
gcgtcggaagacgagaacggcgacgaccagggcttccaggagggggaggacgagctcggc
gacgaagaggagggcgcgggcgacgagaacggccacggggagcagcagtcccaaccgccg
gcggcggcgcagcaggcttctcagcagcgcgggcctggcaaggaggccgcggggaaaagc
agcggccccacctcgctcttcgcggtgacggtggcgccgccaggggcgaggcagggccaa
cagcaggcgggaggagacggcaaaacagaacagaaagctggagataaaaagagaggtgtt
aaaagaccccgggaagatcatggccgaggatattttgagtacattgaagaaaacaagtac
agcagagccaagtctcctcagccacctgttgaagaagaagacgaacacttcgatgacaca
gtggtttgtcttgatacttataattgtgatctgcattttaaaatatcaagagaccgtctc
agtgcttcttcccttactatggagagtttcgcttttctttgggctggaggaagagcttct
tatggtgtgtcaaaaggcaaagtctgctttgagatgaaggtaacagagaagattccagta
agacatttatatacaaaagatattgatatacatgaagttcggattggctggtcactaacc
acaagtggaatgttgcttggtgaagaagaattttcttatgggtattctctgaaaggaata
aaaacctgcaactgtgagacagaagattatggagagaagtttgatgaaaatgatgtgatt
acgtgctttgctaactttgagactgatgaagttgaactctcttacgcaaagaatggacaa
gatcttggtgttgcctttaagattagtaaggaagttcttgctgaccggccattattcccc
catgttctctgccataactgtgcagttgagtttaattttggtcaaaaggaaaagccatac
tttccaatacctgaagactgtacttttatccaaaatgtcccattagaggaccgagtcaga
ggaccaaaaggacctgaagagaagaaggattgtgaagttgtgatgatgattggcttgcca
ggagctggaaaaactacctgggttactaaacatgcagctgaaaaccctgggaaatataac
attcttggaacaaacactattatggacaaaatgatggtggcaggctttaagaagcaaatg
gcagatactggaaaactgaacacactgttgcagagagccccacagtgtcttggcaagttt
attgagattgctgcccgaaagaagcgaaattttattctggatcagacaaatgtgtctgct
gctgcccagaggagaaaaatgtgcctgtttgcaggcttccaacgaaaagccgtggtcgtt
tgcccaaaagacgaagactataagcagaggacacagaagaaagcggaagtagaggggaaa
gacctaccagagcatgctgtcctcaagatgaaaggaaacttcacccttccagaggttgca
gagtgttttgatgaaataacctatgttgaacttcagaaggaggaagcccagaagcttttg
gagcaatataaagaagaaagcaaaaaggcactgccaccagaaaaaaagcaaaacactggc
tcaaagaaaagcaataaaaataagagtggcaagaaccagttcaacagaggtggtggccat
agaggacgtggaggattcaatatgcgtggtggcaatttcagagggggagctcctgggaat
cgtggtggatataataggagaggcaacatgccccagagaggtggtggcggcggaagtggt
ggaattggctatccatacccgcgtggccctgtctttcctggccgaggtggttactcaaac
agaggaaattacaacagaggtggaatgcccaacagagggaactataaccagaacttcaga
ggacgaggaaataatcgtggctacaaaaatcaatctcagggctacaaccagtggcagcag
ggtcaattctggggtcagaagccatggagtcagcattatcaccaaggatattattga

DBGET integrated database retrieval system