KEGG   Rattus norvegicus (rat): 117512
Entry
117512            CDS       T01003                                 

Gene name
C9
Definition
(RefSeq) complement component C9
  KO
K04000  complement component 9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno05020  Prion disease
rno05146  Amoebiasis
rno05171  Coronavirus disease - COVID-19
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    117512 (C9)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    117512 (C9)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    117512 (C9)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    117512 (C9)
  09164 Neurodegenerative disease
   05020 Prion disease
    117512 (C9)
SSDB
Motif
Pfam: MACPF Ldl_recept_a TSP1_spondin TSP_1
Other DBs
NCBI-GeneID: 117512
NCBI-ProteinID: NP_476487
RGD: 620319
Ensembl: ENSRNOG00000013736
UniProt: Q62930 Q5BKC4
Position
2
AA seq 567 aa
MLLRTPGLPRRSGMASGVTITLAIAIFALEINAQAPEPTPREEPSADALLPIDCRMSTWS
QWSQCDPCLKQRFRSRSIEVFGQFQGKSCADALGDRQHCEPTQECEEVQENCGNDFQCET
GRCIKRKLLCNGDNDCGDFSDESDCESDPRLPCRDRVVEESELGRTAGYGINILGMDPLG
TPFDNEFYNGLCDRVRDGNTLTYYRKPWNVAFLAYETKADKNFRTENYEEQFEMFKTIVR
DRTTSFNANLALKFTITEAPIKKVGVDEVSPEKNSSKPKDSSVDFQFSYFKKENFQRLSS
YLSQTKKMFLHVRGMIQLGRFVMRNRGVMLTTTFLDDVKALPVSYEKGEYFGFLETYGTH
YSSSGSLGGLYELIYVLDKASMKEKGVELSDVKRCLGFNLDVSLYTPLQTTLEGPSLTAN
VNHSDCLKTGDGKVVNISRDHIIDDVISFIRGGTRKQAVLLKEKLLRGAKTIDVNDFINW
ASSLDDAPALISQKLSPIYNLIPLTMKDAYAKKQNMEKAIEDYVNEFSARKCYPCQNGGT
AILLDGQCMCSCTIKFKGIACEISKQR
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgcttctcaggactccagggctgcctaggaggagcggcatggcctcaggcgtgaccatc
accctagccattgcaatctttgccttggagatcaatgcacaggccccagagcccactccc
cgggaagagccatcagcagacgccctcctaccaatagactgcagaatgagcacatggagt
cagtggtcacagtgtgatccttgcctcaaacaaaggtttcgctcaagaagcattgaagtc
tttggacagtttcaggggaaaagctgtgctgatgctttgggagacagacaacattgtgaa
cccactcaggagtgtgaagaggtacaggaaaactgtgggaatgactttcagtgtgaaaca
ggcaggtgcataaagaggaaacttctgtgtaatggtgacaacgactgtggagatttttct
gatgagagtgactgtgaaagtgacccacgcctcccgtgccgtgaccgagtggtagaagaa
tcagaactgggacgaacagcaggctatgggatcaacatcttagggatggatcccctgggc
acgccttttgacaatgagttctacaatggactctgtgaccgggtacgggacggaaacact
ttgacatactatcgcaaaccttggaacgtagcatttctggcctatgaaaccaaggctgac
aaaaatttcagaactgagaattatgaagaacagtttgaaatgttcaaaaccatcgtccga
gacaggaccacgagttttaatgcaaatttagctctaaaattcacaatcactgaagcacct
ataaaaaaagttggagttgatgaagtcagcccagaaaaaaactcttcaaagcctaaagac
tcttctgttgattttcaattttcatatttcaagaaagaaaattttcaacgattgtcatcc
tacttgtcacagacgaaaaagatgtttctgcacgtgagaggaatgattcaactggggaga
tttgtcatgaggaatcggggcgttatgctgacgacaactttcctggatgatgtaaaggct
ttaccagtttcctatgaaaagggagaatattttggatttttggaaacctatgggactcac
tacagtagctctgggtccctgggagggctctacgaactgatctatgtcttggataaagct
tccatgaaagagaaaggtgttgaactgagcgatgtaaagcggtgtcttgggtttaacctg
gatgtttctctatatacgcctctacaaaccaccttagaaggaccatcattgacagccaat
gttaatcacagtgattgcttaaagacaggggatggtaaagtagtaaacatcagccgcgat
cacatcatagatgatgttatttcattcataagaggagggaccaggaagcaagcagttctc
ctgaaagagaagcttctcagaggagccaagacgattgatgtgaatgacttcatcaactgg
gcctcatccttggatgacgctccagctctcattagtcaaaaactgtcccctatctataat
ctcattcctttgacaatgaaagatgcatacgcaaagaaacagaatatggaaaaggctatt
gaagactatgtgaatgaattcagtgctagaaagtgctacccatgtcaaaacggaggcaca
gcaattcttctggatggacagtgcatgtgctcctgcacaatcaagtttaaggggattgcc
tgcgaaatcagtaaacaaagatag

KEGG   Rattus norvegicus (rat): 117517
Entry
117517            CDS       T01003                                 

Gene name
C7
Definition
(RefSeq) LOW QUALITY PROTEIN: complement component C7
  KO
K03996  complement component 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno05020  Prion disease
rno05171  Coronavirus disease - COVID-19
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    117517 (C7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    117517 (C7)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    117517 (C7)
  09164 Neurodegenerative disease
   05020 Prion disease
    117517 (C7)
SSDB
Motif
Pfam: MACPF Kazal_3 Sushi Ldl_recept_a
Other DBs
NCBI-GeneID: 117517
NCBI-ProteinID: XP_038959452
RGD: 620318
Ensembl: ENSRNOG00000061379
Position
2
AA seq 847 aa
MKATSLLILVGFMTEFQIFSRASSPVNCEWDSYGPWSECNGCTKTQTRRRSIAVYGQYGG
HRCVGSAFETQSCNPERGCPTEEGCGDRFRCFSGQCISKSLVCNGDSDCEEDGADEDRCE
GAESRPSCDTVKPPPNIELTGNGYNALTGQFRNRVINTKSFGGQCRKVFSGDGRDFYRLS
GNILSYTFQVKIDNDFNYEFYNSSWSYVKHTSTDYTSSSSNRFLFFSSSSNRHTQSSSTK
EIYMKKSYKLLVVQNTVEVAQFINNNPEFXQLAEPFWRELSHLPTLYDYSAYRRLIDQYG
THYLQSGSLGGEYRVLFYVDSGDVKHRGFGSVQEKACSSSDFKFIFVSSANQRCKELENI
FKSNSGNQGRVPSRRAICHRWSPGFVADLVFLDLDNPAXNRQRYSSWASSVTGLPQVINR
GYLTPLYELVKEVPCASVKRLYLKRALEEYLDEFDPCHCRPCQNGGIASVVGTQCQCHCK
PYTYGMACEQGVLVGDQAGGVDGGWSCWSSWSPCVQGRNXRSRECNNPPPRAGGKACIGX
TTESXQCEDQDLENLRLLEPHCFHLSLVPKGFCPSPPALKDGFVQSEGTMFPIGKNIVYA
CNEGYSLVGDPVARCGEDLQWLVGEMHCQKIACFLPGGMNGMRSDPQKPFYMVGEKVTPF
LCXGGMSLEGPSTFLCGSSLKWSPELKSAQCVQKVTSTLTPAAPACQPWEKLKNSKCVCK
MPYECGSSLDVCARDERSNRILPLTICKMHVLQCQGRNYALVGKNSCTLPASTEKACGAC
PIWSKCDAQNSKCVCREASECQKAGYRICVEVNGKEETMSECEAGILRCRGQSISITAIK
PCAQEVQ
NT seq 2544 nt   +upstreamnt  +downstreamnt
atgaaggcaacaagcttattaattttggtgggatttatgacagagtttcaaatcttctca
agagcctcctctccagtcaactgtgagtgggactcctatggcccttggtcagaatgtaat
ggctgtaccaagactcagactcgaaggcgttcgattgctgtttatgggcaatatggaggc
catcggtgtgtggggagtgcttttgaaacacaatcctgcaaccctgaacgaggctgtcca
actgaagagggctgtggggaccggtttaggtgtttttcaggtcagtgcatcagcaaatcg
ttggtttgcaatggggattctgactgtgaggaagatggtgctgatgaagacagatgcgag
ggtgccgaaagcagaccttcctgtgacactgttaaaccccctcccaacatagaacttacc
ggcaacggttacaatgcacttactggccagtttaggaacagagtcatcaacaccaaaagt
ttcggtggtcagtgcaggaaagtgttcagcggggacggaagagatttctacagactgagt
ggaaatatcctctcttatacctttcaggtcaaaatagataatgattttaactatgaattt
tacaacagcagttggtcttacgtaaagcatacatccacagactatacatcatctagttca
aacaggttcttatttttctcctcctcatcaaatcgacacactcagagttcaagtaccaag
gaaatctacatgaaaaagagttataaactgttggttgttcagaacacggttgaagtggcc
cagtttattaataataatcctgaatttntacaacttgcggagccattctggagggaactc
tcccaccttcccactctgtatgactatagtgcctaccgacggttaattgaccagtatggg
acacattacctgcagtccgggtccttaggaggagaatatagagttctattttatgtggat
tcaggagatgtcaaacacaggggatttggatctgtccaggagaaggcatgttcctcttca
gactttaagtttatttttgtatcatcagcaaatcagagatgtaaggaactggaaaacatt
ttcaagtcaaattcaggaaaccagggcagggtgccttcgaggagagccatctgtcatcgg
tggagccctggctttgtagctgacctagttttcctggacctggataatcctgctnggaac
agacagcgctactcctcctgggccagctctgtaacaggtcttccccaagtcataaacaga
gggtatctgacaccgttgtacgagctggtcaaggaagtgccctgtgcctctgtgaaaaga
ctgtacctgaagcgggctcttgaggagtacttagatgaatttgacccctgccattgccgg
ccttgccagaatggtggcatcgctagtgttgtggggacacagtgccagtgtcactgcaaa
ccatacacatatggtatggcgtgtgagcaaggagtccttgtcggcgatcaagcaggaggg
gttgatggaggctggagctgttggtcctcttggagcccctgtgttcaaggaagaaatnnc
aggagccgagaatgcaataatccccctcccagagcgggtggaaaggcctgtattggataa
acgactgaaagcnagcagtgcgaagaccaggacttggagaacttgcgattacttgagcca
cattgctttcatttgtctttggttccaaaaggattctgcccatcaccccctgccttaaaa
gatggatttgttcaaagtgaaggtaccatgtttcctattggaaaaaacatagtatatgct
tgcaatgaagggtattctcttgtcggagatcctgttgccagatgtggagaagacttacag
tggcttgtgggggaaatgcactgtcaaaaaattgcctgttttctacctggagggatgaat
ggcatgcggagtgacccccagaaacccttctacatggttggtgagaaggtgacccctttc
ctgtgcnacggtggtatgtccttagaaggtccttccaccttcctctgcggctccagcctt
aagtggagtcctgagctgaagagtgcccagtgtgtgcaaaaagtcaccagcactctaaca
ccagcagctcctgcatgtcagccctgggagaaactgaagaactcaaaatgcgtctgcaaa
atgccctatgagtgcggatcctccttggatgtgtgtgcccgagatgagcgaagcaacagg
atactgcctttgaccatctgcaagatgcatgttctccagtgtcagggaagaaattatgct
ctcgttggcaagaacagctgtactctgcctgcctcgactgagaaagcgtgtggtgcatgc
ccaatatggagcaaatgtgatgctcagaacagcaaatgtgtctgcagagaagcgtcggag
tgccagaaagcagggtacagaatctgcgtggaagtgaatggcaaagaggagacaatgtcc
gagtgcgaggctggcatcttaaggtgcagagggcagagcatctccatcacagccataaag
ccctgtgcccaagaagtccagtag

KEGG   Rattus norvegicus (rat): 24237
Entry
24237             CDS       T01003                                 

Gene name
C6
Definition
(RefSeq) complement component C6 precursor
  KO
K03995  complement component 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno05020  Prion disease
rno05171  Coronavirus disease - COVID-19
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    24237 (C6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    24237 (C6)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    24237 (C6)
  09164 Neurodegenerative disease
   05020 Prion disease
    24237 (C6)
SSDB
Motif
Pfam: MACPF Sushi TSP_1 TSP1_spondin Ldl_recept_a
Other DBs
NCBI-GeneID: 24237
NCBI-ProteinID: NP_788263
RGD: 2238
Ensembl: ENSRNOG00000024115
UniProt: Q811M5
Position
2
AA seq 934 aa
MTRHLTLCFILLIILIDKSEACFCDHYPWTHWSSCSKSCNSGTQSRQRQIVVNDYYRDNS
CDQLCTKQETRQCNVETCPINCVLGDYGTWSDCDPCIRKQVKVRSVLRPSQFGGQPCTEP
LVTFQPCVPSELCKIEETDCKNKFLCDSGRCIPSKLKCNGENDCGDNSDERNCGRTKPVC
SRTYTPIPSVQLMGAGFHFLAGEPRGDVPDNSFTGGICKSVRSSRTSNPHRVPANLENVN
FEVQTIEDDLKTDFYKDLATIGKNKNEDRSLSGEKKDSFYVPIFYSSKKSENFQRNSGFK
NAIEASHKKDSSFVRIHKVIKVLNFTMKTTDLQLSDVFLKALIHLPLEYNFALYSRIFDD
FGTHYFTSGSLGGKYDLLYQFSRQELQNSGLTEEETRNCVRYETKKRFLFFTKTYKEDRC
TTNRLSEKYKGSFLQGSEKSISLVQGGRSQQAAALAWEKGSSGPEANVFSEWLESVKENP
AVVDYELAPIIDLVRNIPCAVTKRNNLRKALQEYAAKFDPCQCAPCPNNGRPRLSGTECL
CVCQSGTYGENCEKRSPDYKSNAVDGNWGCWSSWSACNAAYRRSRSRECNNPEPQRGGQR
CEGKHWQEEDCTFSIMEKVGQPCISDDEEIKEVDLAEPEADSGCPQPPLPENAFVWNEKK
LYSVGEEVEISCLTGFKAVGYQYFRCLPDRTWRQGDVECQRTECLKPVVQDVLTISPFQS
VYKIGESIELTCPRGFVVAGPSRYTCKGDSWTPPIPNSLSCEKDILTKSKGLCQPGQKQS
GSECVCMSPEEDCSSYSEDLCIFDEGSSQYFTSSACKFLAEKCLNSNQFHFVHAGSCQEG
PQLEWGLERLKLAMKSTKRVPCGYDTCYDWEKCSAHTSNCVCLLPPQCPKDENQLHCVKM
GSSMRGKTVNICTLGAVRCANRKVEILNPGRCLD
NT seq 2805 nt   +upstreamnt  +downstreamnt
atgaccagacatctcaccttgtgtttcattttgctgatcatactgattgacaagagtgaa
gcctgtttctgtgaccactacccatggactcactggtccagctgttctaagtcctgcaat
tctggaacccagagcagacagagacaaatcgtagtgaacgattactatcgggataactca
tgcgatcagctctgtaccaagcaggagaccagacagtgcaacgtggagacatgtcccatc
aactgtgtcctaggagactatggaacatggtcagactgtgacccttgtattagaaaacag
gttaaagttagatctgttctgcgcccaagtcagtttgggggacaaccatgcacagagccc
ctggtgacctttcaaccatgtgtcccatctgagctctgcaaaattgaagagactgattgc
aagaataaattcctctgtgacagtgggcgctgtattcccagcaagttaaaatgcaatgga
gaaaatgactgtggagacaattcagacgaaaggaactgtgggaggacaaagccagtatgc
tcacggacatacactcctatccccagtgtgcagctgatgggcgctgggtttcattttctg
gcaggagagcccagaggagatgtccctgataactccttcactggaggaatatgtaaatcc
gtcaggagcagccgaacgagtaatccacaccgagttccagccaatctggaaaatgtcaac
tttgaggtacaaactatagaagatgacttgaaaacagatttctacaaggatttagccact
attggaaaaaataaaaatgaagaccgttcattgtctggtgagaagaaagactctttctac
gtaccaattttttattcctcaaagaaaagtgaaaatttccaacgtaactcaggcttcaaa
aacgccattgaagcctcccacaagaaggattcgagctttgttaggatccataaagtgata
aaagtcttaaacttcacaatgaaaacgacagacctgcagctctcagacgtcttcctaaaa
gccctcatccacctgcctttagaatacaactttgctttgtacagccggatatttgatgac
tttgggacccactatttcacctcaggctcccttgggggcaagtatgaccttctctaccaa
ttcagccgccaggagctacagaactcaggtttaacagaagaagaaactcgaaactgtgtc
cggtatgaaacaaagaaacgtttcttattttttacgaaaacatacaaggaagaccggtgt
accacaaataggctgtctgaaaagtacaaaggttcctttttacagggatcggagaaatct
atatccctggtccagggcgggaggagtcagcaggcagcagccttggcttgggagaagggc
agctctggtccagaggcgaatgtcttctctgagtggttagagtcggtgaaggaaaaccct
gctgtggttgattatgagcttgctccgatcatcgacttggtcagaaacatcccatgtgca
gtgacaaaacggaacaacctcaggaaagcccttcaagaatatgcagccaagtttgaccct
tgccaatgtgctccatgtcctaataatggccgccccaggctctcaggcacagaatgtttg
tgtgtgtgccagagtggtacctacggtgagaactgtgaaaaacggtccccagattataaa
tcgaatgcagtggatgggaactggggctgctggtcttcctggagcgcatgcaatgctgct
tataggaggtcaaggagccgggagtgtaataaccctgagccacagcgaggagggcagcgc
tgtgagggcaagcattggcaagaagaagactgtacattctcaataatggaaaaagttgga
caaccgtgcatcagtgatgatgaagaaataaaagaagtagaccttgctgagccagaagca
gattcagggtgtcctcagccacctctcccagaaaatgcatttgtctggaatgaaaagaaa
ctgtactcagtcggggaggaagttgaaatttcatgtctcactggattcaaagctgtggga
taccagtacttcagatgcttaccagacagaacctggaggcaaggggatgtcgaatgccaa
cggaccgagtgcctcaaaccagtcgttcaggatgtcctgaccatctccccatttcagagt
gtgtacaagattggggaatccattgagctgacctgtcccagaggctttgttgttgctggc
ccatcgaggtatacatgcaagggagactcctggacacctcccattccaaattcactgagc
tgtgaaaaagatattctgacaaagtcaaagggcctttgtcaaccaggacaaaagcaatca
ggatccgagtgtgtttgtatgtccccagaagaagactgtagcagttattcggaagatctc
tgtatatttgatgagggatccagtcagtacttcacttcatctgcttgcaaatttttggct
gaaaaatgtttaaacagcaaccagttccactttgtccatgctggttcctgccaagaaggc
ccacagttagaatggggtcttgagaggctaaaactcgcaatgaagagcacaaagagagtg
ccctgtggatatgatacttgctatgactgggaaaaatgttcagcccacacctccaactgt
gtctgcctattgcccccacaatgccccaaggatgaaaaccaactccactgtgtcaaaatg
ggatcatcaatgcgtgggaaaacagtaaacatctgtacactgggagccgtgaggtgtgca
aacaggaaggtggaaatactgaatcctgggaggtgcttggattag

KEGG   Rattus norvegicus (rat): 296545
Entry
296545            CDS       T01003                                 

Gene name
C8g
Definition
(RefSeq) complement component C8 gamma chain
  KO
K03999  complement component 8 subunit gamma
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno05020  Prion disease
rno05146  Amoebiasis
rno05171  Coronavirus disease - COVID-19
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    296545 (C8g)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    296545 (C8g)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    296545 (C8g)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    296545 (C8g)
  09164 Neurodegenerative disease
   05020 Prion disease
    296545 (C8g)
SSDB
Motif
Pfam: Lipocalin
Other DBs
NCBI-GeneID: 296545
NCBI-ProteinID: NP_001100025
RGD: 1309074
Ensembl: ENSRNOG00000028701
UniProt: D3ZPI8
Position
3
AA seq 164 aa
MLQGPERHFAGTWLLVAVGSACRFLQEQGHRAEATTLHIAPQGAAMAASTFRKLDGICWQ
VRQLYGITGVPGRFLLQAPRARGPVHVVVAETDYQSFAILYLEQARRLSVKLYTRTLPVS
DSALNAFEERVRGANLTEDQIFFFPKYGFCETADQFHILNEMPK
NT seq 495 nt   +upstreamnt  +downstreamnt
atgctccagggcccagagagacattttgcagggacatggctccttgtggctgtgggctct
gcatgccgctttcttcaggagcagggacaccgggctgaggccactacattgcacatagct
ccccagggtgcagctatggctgccagcaccttccgaaagctagacgggatctgctggcag
gtgcgccaactctatggaatcacaggggtccctggccgcttcttgctccaagctccacgg
gcccgtgggccagtacatgtggttgttgctgagaccgactaccagagctttgccatcctg
tatctggagcaggcgaggaggctgtctgtgaaactatacacccgcacactgcctgtgagt
gattctgccctgaatgcgtttgaggagcgagtcaggggagccaacctgacagaagaccag
atctttttctttcccaagtatggtttctgtgagactgcagaccaattccacatcctgaat
gagatgccgaagtga

KEGG   Rattus norvegicus (rat): 298288
Entry
298288            CDS       T01003                                 

Gene name
C8a
Definition
(RefSeq) complement component C8 alpha chain precursor
  KO
K03997  complement component 8 subunit alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno05020  Prion disease
rno05146  Amoebiasis
rno05171  Coronavirus disease - COVID-19
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    298288 (C8a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    298288 (C8a)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    298288 (C8a)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    298288 (C8a)
  09164 Neurodegenerative disease
   05020 Prion disease
    298288 (C8a)
SSDB
Motif
Pfam: MACPF Ldl_recept_a TSP_1 TSP1_spondin Cofilin_ADF
Other DBs
NCBI-GeneID: 298288
NCBI-ProteinID: NP_001100140
RGD: 1308355
Ensembl: ENSRNOG00000007697
UniProt: D3ZWD6
Position
5
AA seq 587 aa
MFTVAFFGLSLMAWHSGVTAQEKVNQRVTRAVTPGAVACQLSDWSEWTDCFPCQNEKYRY
RSLLQPSKFGGTICSGDIWDKANCDSPTPCLRQAQCGQDFQCRETGRCLKRHLVCNGDQD
CLDGSDEDNCDDARVIEDDCRQYEPIPGSERAALGYNILTQEEGQSVYDAKYYGGQCETV
YNGDWRRLQYDPTCERLYYGEDEKYFRKPYNFLKYHFEALADTLISSEFYDDANDLFSKI
QRDKSQSNSVTFGISPAKSPITLDASVSWSDESSFMKELSKYNEKKYSFMRVSTKVQTAH
FKMRRHNIVLDEGMMESLMELPEQFNYGMYSKFINDYGTHYITSGTMGGIYEYVLVLDKE
KMRIHGITVEDVKKCIGGGVGLQFGEKIIGEGDLSGESCVMTGDGNQDKRKKDLAVEDII
SRVQGGSSRWSTGLAHNSSAITYRSWGRSLKYNPVVIDFEMQPIYQLLQHTNLGPLETKR
RNLRRALDQYLMEFNACRCGPCFNNGVPILEGTSCSCQCSMGRQGPACESMVLEAMEGAK
ADGRWSCWSSWSECRGGSRERRRQCNNPAPQNGGAPCLGKSLQTQAC
NT seq 1764 nt   +upstreamnt  +downstreamnt
atgtttacagttgctttctttggtttgtctctgatggcatggcactccggggtaactgca
caagagaaggtgaaccagcgggtcacccgagctgtgaccccaggagcggttgcctgtcag
ttgagtgactggtcagaatggacagattgttttccatgtcagaacgaaaagtaccgatac
cggagcctcttgcagccaagcaagtttggaggaaccatctgcagtggtgatatatgggat
aaggccaactgtgacagccccacaccttgtctaaggcaagcacagtgtggacaggatttc
cagtgtagagagacaggtcgctgcctgaaacgccacctggtatgcaatggagatcaggac
tgccttgatggctctgatgaggataactgtgatgatgccagggtcattgaagatgattgc
cgtcagtatgaaccaatcccaggatcagaaagggcagccttggggtacaatatcctgact
caagaagaaggccagagtgtgtatgatgctaagtattatggaggccagtgtgaaactgtg
tacaatggagactggagaaggctgcagtacgaccccacctgtgagcgcctctactatggg
gaggatgagaaatacttccggaagccctacaacttccttaagtaccactttgaagccctg
gcggatactttaatctcttcagagttttatgatgatgcaaatgaccttttttctaagata
cagagggacaaatcccagtcaaatagtgtaacatttggcataagcccagcaaaaagtcct
atcacactagacgcgtccgtatcctggtccgatgaatcttccttcatgaaggagttaagc
aagtataatgagaagaaatatagcttcatgagagtgtccacgaaggtacagacggcacat
tttaagatgaggaggcacaatattgtgctggatgaagggatgatggagtcactgatggag
ctcccagagcagtttaactacggcatgtactccaagttcatcaatgactatggcacccac
tacatcacctctggaaccatgggtggcatttacgaatatgttctggtgcttgacaaagag
aaaatgagaattcatggcattactgtggaagatgtcaaaaaatgcatcggaggtggcgtt
ggcctgcagtttggagagaaaataattggtgaaggagatttatcaggagagtcttgtgtc
atgactggagatggcaaccaggacaaaaggaagaaggacttggcagtggaggacatcatt
tctcgggtacaaggtggaagttctcgctggagcactggcttggcacacaacagcagtgct
attacataccggtcttgggggagatcattaaagtataaccctgttgttatcgattttgag
atgcagcccatctatcagctactgcagcacacaaacctggggcctctggagactaaacgt
cggaacctgcgcagggctttggaccagtacctgatggaatttaatgcctgccgctgtggg
ccctgcttcaacaatggggtacccatactcgagggcaccagctgctcgtgtcaatgtagc
atgggccggcagggccctgcctgtgagagcatggtattggaagcgatggagggagccaaa
gctgatggtcgttggagctgctggagttcctggtcagagtgtagaggagggtcccgggag
aggaggagacagtgcaacaatccagcaccccagaatggaggtgccccatgcctagggaag
agcctgcagacccaggcctgctga

KEGG   Rattus norvegicus (rat): 313421
Entry
313421            CDS       T01003                                 

Gene name
C8b
Definition
(RefSeq) complement component C8 beta chain precursor
  KO
K03998  complement component 8 subunit beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno05020  Prion disease
rno05146  Amoebiasis
rno05171  Coronavirus disease - COVID-19
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    313421 (C8b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    313421 (C8b)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    313421 (C8b)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    313421 (C8b)
  09164 Neurodegenerative disease
   05020 Prion disease
    313421 (C8b)
SSDB
Motif
Pfam: MACPF Ldl_recept_a TSP_1 TSP1_spondin
Other DBs
NCBI-GeneID: 313421
NCBI-ProteinID: NP_001178688
RGD: 2239
Ensembl: ENSRNOG00000007639
UniProt: P55314
Position
5
AA seq 589 aa
MKTGAQVWRALAKSCLLCAALGCLHLPGARGEKPDFFETNAVNGSLVRSRPVRSVDVTPA
PTDCQLSTWSSWTACDPCQKKRYRHTYLLRPSQFYGELCDFSDKEVEDCVTNRACRSQVR
CEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKKCSQDMEQYWAIGNLASGINL
FTNTFEGPVLDHRYYAGACSPHYILNTNFRKPYNVESYTPQTQGKYEFALTEYESYFDFE
HNVTEKATSKSSFKFGFKLDGLVEFGVRKESNEGRHYISRTKRFSHTKSKFLHARSVLEV
AHYKLKSRQLMLHYEFLQRVKSLPLEYSYGEYRDLLRDFGTHFITEAVLGGIYEYTLIMN
KDAMERGDYTLDHVSACAGGGFQIGGNVYKVYLKLGVSEKKCSDILNEIKDRNKRRTMVE
DLVVLVRGGTSEYITSLAYKDLPTAELMKEWGDAVQYNPAIIKLKAEPLYELVTATDFAY
SSTVKQNMKKALEEFQMEVSSCRCAPCRNNGVPILKESRCECICPAGFQGVACEVTNRKD
IPIDGKWSCWSDWSPCSGGRKTRQRQCNNPAPQRGGSPCSGPASETLDC
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgaagacaggggcccaggtttggagggcactggcaaagtcatgtcttctttgtgctgcc
cttggatgtctccatctccctggtgcaagaggtgagaagccagatttctttgagacaaat
gcagtcaatggaagccttgttaggagcagaccagtacggagtgtggatgtcaccccagca
cctactgactgtcaactatccacctggtcctcctggactgcatgtgacccctgtcagaag
aaaaggtacagacacacttacttgctccggccctctcagttctatggggaactgtgtgac
ttctccgacaaggaagttgaagactgtgttaccaaccgagcctgcagaagtcaagtacga
tgtgaaggctttgtgtgtgcacagacagggaggtgtgtgaatcgcagactcctctgcaat
ggagacaatgactgtggagaccaatcagatgaagccaactgtaggaggatttataaaaaa
tgctcacaggatatggaacagtactgggcaattggcaatctggccagcgggataaatctg
ttcacgaacacttttgagggcccagttctcgatcaccggtattatgctggcgcttgctcc
ccccactacatcctgaacaccaattttaggaagccatacaacgtagagagctacacccca
cagacccaaggcaaatatgaatttgcacttacagaatatgaatcctatttcgattttgaa
cataatgtgacagaaaaagcaaccagcaagtctagtttcaagtttggttttaaactggat
ggcctggttgagtttggagtgagaaaagaaagcaacgagggcagacattacattagcaga
accaaacggttctcccacactaaaagcaagtttctgcacgcgcgctctgtccttgaagtg
gcgcattacaagctgaagtccagacagctcatgctccattacgaattccttcagagggtc
aagagcctgcccctggagtacagctatggagaataccgagatctccttcgtgactttggg
acccatttcatcaccgaagccgtgcttgggggcatctacgagtacacgcttatcatgaac
aaagacgccatggagcgaggagattacactctggaccatgtttcagcctgtgccggagga
ggtttccagattggtggtaacgtctataaagtctacctcaaattgggtgtgtccgaaaag
aaatgcagtgacattctgaatgaaatcaaagacagaaataagagacgcaccatggtagaa
gacttggtagttcttgtgcgaggagggacaagtgagtacatcacctccttggcatacaag
gatctgccaacagcagagctgatgaaggaatggggcgatgctgtgcagtacaacccagcc
atcatcaagctcaaggctgagcccctgtatgaacttgtgacagccacagactttgcgtac
tccagcacagtgaaacagaacatgaagaaggccctagaagaattccagatggaggtcagc
tcctgccgctgtgctccgtgcaggaacaatggagtccccatcctgaaagaatcccgctgt
gagtgcatctgtcctgctggcttccaaggtgtagcctgtgaggtcaccaatcggaaagat
atccccatagatgggaagtggagttgctggtctgactggtctccatgctctggaggacgc
aaaacaagacaaaggcagtgcaacaacccggcacctcagagaggaggcagcccctgctca
ggtcctgcttcagaaacactcgactgttaa

DBGET integrated database retrieval system