KEGG   Rattus norvegicus (rat): 117513Help
Entry
117513            CDS       T01003                                 

Gene name
Sec22a, Sec22l2
Definition
(RefSeq) SEC22 homolog A, vesicle trafficking protein
  KO
K08520  SEC22 vesicle trafficking protein A/C
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    117513 (Sec22a)
Membrane trafficking [BR:rno04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   Putative SNAREs
    117513 (Sec22a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Longin VKOR
Motif
Other DBs
NCBI-GeneID: 117513
NCBI-ProteinID: NP_476488
RGD: 621659
Ensembl: ENSRNOG00000043069
UniProt: Q642F4
Position
11q22
AA seq 307 aa AA seqDB search
MSMILSASVVRVRDGLPLSASTDCEQSAGVQECRKYFKMLSRKLAQFPDRCTLKTGRHNI
NFISSLGVSYMMLCTENYPNVLAFSFLDELQKEFITTYNMMKTNTAVRPYCFIEFDNFIQ
RTKQRYNNPRSLSTKINLSDMQMEIKLRPPYQIPMCELGSANGVTSAFSVDCKGAGKISS
AHQRLEPATLSGIVAFILSLLCGALNLIRGFHAIESLLQSDGEDFSYMIAFFLGTAACLY
QCYLLVYYTSWRNVKSFLTFGLICLCNMYLYELRNLWQLFFHVTVGAFVTLQIWLRQAQG
KAPDHDV
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgattttatccgcctcagtcgtgcgtgtcagggatggattaccgctgtctgca
tccactgattgtgaacagagtgcaggagtgcaggagtgcaggaagtactttaagatgctc
tcgaggaagcttgctcaatttcctgatagatgtacactgaaaactggacgccataacatt
aattttattagctctctcggcgtgagctacatgatgttgtgcactgaaaattatccaaat
gttctcgccttctctttcctggatgagcttcagaaggagttcattactacttataacatg
atgaagacaaatactgctgtcagaccatactgtttcattgaatttgataacttcattcag
aggaccaagcagcgatataataatcccaggtctctttcaacaaaaataaatctgtctgac
atgcagatggaaatcaagctgaggcccccttaccaaatcccaatgtgtgaactgggatca
gccaatggagtcacgtctgcattttctgttgactgtaaaggtgctggtaagatttcttct
gcccaccagcgactagaaccagcaactctgtcagggattgtggcatttatccttagtctt
ttatgtggagctctgaatttaattcgaggctttcatgccattgaaagcctcctgcagagt
gatggtgaggactttagttacatgattgcatttttccttgggacagcggcctgcctttac
cagtgttatttacttgtgtactacaccagctggcggaatgtcaaatcattcctgactttt
ggcttaatctgtctttgcaacatgtatctctacgaactgcgcaacctctggcagcttttc
tttcatgtgactgtgggagcatttgtcacactgcagatctggctgaggcaagcccaaggc
aaggctcctgaccatgacgtctga

DBGET integrated database retrieval system