KEGG   Rattus norvegicus (rat): 117518
Entry
117518            CDS       T01003                                 

Gene name
Ccl17
Definition
(RefSeq) C-C motif chemokine 17 precursor
  KO
K21083  C-C motif chemokine 17
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    117518 (Ccl17)
   04061 Viral protein interaction with cytokine and cytokine receptor
    117518 (Ccl17)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    117518 (Ccl17)
   04657 IL-17 signaling pathway
    117518 (Ccl17)
   04062 Chemokine signaling pathway
    117518 (Ccl17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    117518 (Ccl17)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   117518 (Ccl17)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 117518
NCBI-ProteinID: NP_476492
RGD: 619924
Ensembl: ENSRNOG00000016278
UniProt: Q9ERE0
Position
19
AA seq 93 aa
MMSLQMLLLAALLLGTSLQHASAARATNVGRECCLDYFKGAIPIRKLVTWFRTSVECPKD
AIVFETVQGRLICTDPKDKHVKKAIRHLKNQRL
NT seq 282 nt   +upstreamnt  +downstreamnt
atgatgtcacttcagatgctgctcctggctgccctgcttctggggacttctctgcagcat
gccagcgctgctcgagccaccaatgtaggccgagagtgctgcctggactacttcaagggg
gccattcccatcaggaagctggtgacgtggttcaggacctcagtggagtgtcccaaggat
gccatcgtgtttgagactgtccagggaaggcttatctgcacagaccccaaagacaagcat
gtgaagaaggccatcagacacctgaaaaaccaaaggctgtga

DBGET integrated database retrieval system