KEGG   Rattus norvegicus (rat): 117522
Entry
117522            CDS       T01003                                 

Gene name
Xpnpep2
Definition
(RefSeq) X-prolyl aminopeptidase 2
  KO
K14208  Xaa-Pro aminopeptidase 2 [EC:3.4.11.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    117522 (Xpnpep2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    117522 (Xpnpep2)
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    117522 (Xpnpep2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.9  Xaa-Pro aminopeptidase
     117522 (Xpnpep2)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M24
   117522 (Xpnpep2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Enzymes
  117522 (Xpnpep2)
SSDB
Motif
Pfam: Creatinase_N_2 Peptidase_M24 Creatinase_N Peptidase_M24_C
Other DBs
NCBI-GeneID: 117522
NCBI-ProteinID: NP_476496
RGD: 621277
Ensembl: ENSRNOG00000004009
UniProt: Q99MA2
Position
Xq36
AA seq 674 aa
MAQAYWQCYPWLVLLCACAWSYPGPESLGREDVRDCSTNPPRLPVTAVNTTMRLAALRQQ
MEKSNLSAYIIPDTDAHMSEYIGKHDERRAWISGFTGSAGTAVVTKKKAAVWTDSRYWTQ
AERQMDCNWELHKEVSISSIVAWILAEVPDGENVGFDPFLFSVGSWENYDQELQDSNRHL
LSITTNLVDVAWGSERPPVPSQPIYALPKEFTGSTWQEKVSAIRSYMQNHTMAPTGVLLS
ALDETAWLFNLRSSDIPYNPFFYSYTLLTDSSIRLFVNKSRFSLETLQYLNTNCTLPMCV
QLEDYSQIRDGVKAYASGNVKILIGISYTTYGVYDVIPKEKLVTETYSPVMLIKAVKNSK
EQALLKASHVRDAVAVIQYLVWLEKNVPKGTVDEFSGAEHIDQLRRNENFSSGPSFETIS
ASGLNAALAHYSPTKELHRKLSLDEMYLVDSGGQYWDGTTDITRTVHWGTPTAFQKEAYT
RVLMGNIDLSRLVFPAATSGRVVEAFARRALWEVGLNYGHGTGHGIGNFLCVHEWPVGFQ
YNNMAMAKGMFTSIEPGYYQDGEFGIRLEDVALVVEAKTKYPGTYLTFELVSFVPYDRNL
IDVSLLSPEQLQYLNRYYQTIRENIGPELQRRQLLEEFAWLERHTEPLSASAPHTTSLAS
MWVASALAILSWSC
NT seq 2025 nt   +upstreamnt  +downstreamnt
atggcccaagcctactggcaatgctacccctggcttgttctcctctgtgcatgtgcatgg
agttacccagggcctgagtcccttggaagagaagatgtgagagactgttcaaccaatcct
ccgcgcctgccagttactgctgtcaatacaacaatgcggcttgcagccctccgccagcag
atggagaagtcgaatctctctgcctacatcatcccagacacggatgcacacatgagtgag
tatattggcaaacatgatgagaggcgagcatggatttctggcttcacagggtctgcaggt
actgctgtggtgaccaagaaaaaagcagctgtctggaccgatagtcgttactggactcag
gccgagaggcagatggactgcaattgggaactccataaggaagttagcatttcgtcaatt
gtcgcctggatcttagctgaagtccctgatggagagaatgtgggctttgaccccttcctc
ttttctgttggttcctgggaaaattatgatcaagaactccaagactccaacagacacctt
ttatccattacaaccaaccttgtcgacgtggcatgggggtcagagaggcccccagtgcca
agccaacccatttatgccctgccaaaagaatttacaggaagcacttggcaggaaaaagta
tccgccatccgaagctatatgcagaaccacaccatggctccaactggggttcttctatcc
gcactcgatgagacagcctggctcttcaacctccgtagcagtgacatcccctataacccc
ttcttctactcctatacgctgctcacggactcttccatcaggttgtttgtcaacaagagt
cgctttagcctggagaccctgcagtacctgaatacaaactgcacactacccatgtgtgta
caacttgaagactacagtcaaattcgtgatggtgtgaaagcctatgcttcaggcaatgtg
aaaatcttgattgggatcagctataccacctatggggtctatgatgtgataccaaaggaa
aaactcgtgacagagacctactccccagtgatgttaatcaaggctgtgaagaacagcaag
gagcaggccctcttgaaagccagccatgtgcgggacgctgtggctgtgatccagtacttg
gtctggttggagaagaacgtgcccaaaggcacggtggatgagttttctggagcggaacac
attgatcagttacgacggaatgaaaacttctcctctggacccagttttgaaaccatttct
gctagtggcctgaacgccgccctggcccattacagcccaacaaaagagctgcaccgtaag
ctgtccttagatgagatgtacctggtggattctggaggccaatactgggatgggaccaca
gatatcaccagaacagtacactggggtactcctactgcctttcaaaaggaggcttacacg
cgtgtgctgatgggaaacatcgatctgtccagacttgtctttcctgctgctacatcaggg
agagtggtggaagcctttgctcgaagagccttatgggaagttgggctcaattatggtcat
gggacaggccatggcattggtaatttcctctgcgtgcatgagtggccagtggggttccag
tataacaacatggccatggccaaaggcatgttcacttccatcgaacctggatactaccag
gatggggaatttggaatccgtcttgaagacgtcgccctcgtggtagaagcaaagaccaag
tacccagggacctacctgacttttgaattggtatcctttgtaccctatgaccgaaacctc
attgatgtcagcctgctgtccccagagcagctccagtacctgaaccgctactaccagacc
atccgtgagaacataggcccagaactgcagcgtcgccagctgctggaggaattcgcatgg
ctggagcggcacacagagcccctgtcagccagtgcccctcataccacgtccttggcctct
atgtgggtagcctctgcccttgccatcctcagctggagttgctag

DBGET integrated database retrieval system