KEGG   Rattus norvegicus (rat): 117526
Entry
117526            CDS       T01003                                 

Gene name
Tbp
Definition
(RefSeq) TATA-box-binding protein
  KO
K03120  transcription initiation factor TFIID TATA-box-binding protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03022  Basal transcription factors
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    117526 (Tbp)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    117526 (Tbp)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    117526 (Tbp)
   05165 Human papillomavirus infection
    117526 (Tbp)
  09164 Neurodegenerative disease
   05016 Huntington disease
    117526 (Tbp)
   05017 Spinocerebellar ataxia
    117526 (Tbp)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    117526 (Tbp)
   03021 Transcription machinery [BR:rno03021]
    117526 (Tbp)
Transcription factors [BR:rno03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   TATA-binding proteins
    117526 (Tbp)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     117526 (Tbp)
  RNA polymerase III system
    TFIIIB
     117526 (Tbp)
  RNA polymerase I system
    SL1/TIF-1B
     117526 (Tbp)
SSDB
Motif
Pfam: TBP EPL1 Spt20 TFIIA Presenilin
Other DBs
NCBI-GeneID: 117526
NCBI-ProteinID: NP_001004198
RGD: 67398
Ensembl: ENSRNOG00000001489
UniProt: Q66HB1
Position
1
AA seq 318 aa
MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPVQNTNSLSILEEQQRQQQ
QQQQQQQQQQQQAVATAAASVQQSTSQQPTQGASGQTPQLFHSQTLTTAPLPGTTPLYPS
PMTPMTPITPATPASESSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVI
MRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGS
CDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEI
YEAFENIYPILKGFRKTT
NT seq 957 nt   +upstreamnt  +downstreamnt
atggaccagaacaacagccttccaccttatgctcagggcttggcctccccacagggtgcc
atgactcctggaattcccatcttcagtccaatgatgccttacggcacagggcttactcca
cagcctgttcagaacaccaatagtttatctattttggaagagcaacaaagacagcagcag
cagcagcagcagcagcaacagcagcagcaacagcaggcagtagcaactgcagcagcctca
gtacagcaatcaacatctcagcagcccacacagggtgcctcaggccagaccccacaactc
ttccattctcaaactctaaccacagcaccattgccaggcaccacccccttgtatccttca
ccaatgactcctatgacccctatcactcctgccacaccagcctctgagagctctgggatt
gtaccacagctccaaaatattgtatccaccgtgaatcttggctgtaaacttgacctaaag
accattgcacttcgtgccagaaatgctgaatataatcccaagcggtttgctgcagtcatc
atgagaataagagagccacgaacaactgcgttgatcttcagttctgggaaaatggtgtgc
acaggagccaagagtgaagaacaatccagactagcagcaagaaaatacgctagagttgtg
cagaagctgggcttcccagctaagttcttagacttcaagatccagaacatggtggggagc
tgtgatgtgaagttccccataaggctggaaggccttgtgttgacccaccagcagttcagt
agctatgagccagaattatttcctggattaatctacagaatgatcaaacccagaattgtt
ctccttatttttgtttctggaaaagttgtattaacaggtgctaaagttagagcagagatt
tatgaagcatttgaaaacatctaccccatcttaaagggattcaggaagaccacatag

KEGG   Rattus norvegicus (rat): 680050
Entry
680050            CDS       T01003                                 

Gene name
Tbpl2
Definition
(RefSeq) TATA box-binding protein-like 2
  KO
K03120  transcription initiation factor TFIID TATA-box-binding protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03022  Basal transcription factors
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    680050 (Tbpl2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    680050 (Tbpl2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    680050 (Tbpl2)
   05165 Human papillomavirus infection
    680050 (Tbpl2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    680050 (Tbpl2)
   05017 Spinocerebellar ataxia
    680050 (Tbpl2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    680050 (Tbpl2)
   03021 Transcription machinery [BR:rno03021]
    680050 (Tbpl2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   TATA-binding proteins
    680050 (Tbpl2)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     680050 (Tbpl2)
  RNA polymerase III system
    TFIIIB
     680050 (Tbpl2)
  RNA polymerase I system
    SL1/TIF-1B
     680050 (Tbpl2)
SSDB
Motif
Pfam: TBP DUF3378
Other DBs
NCBI-GeneID: 680050
NCBI-ProteinID: NP_001092831
RGD: 1596837
Ensembl: ENSRNOG00000033682
UniProt: A6H909
Position
3
AA seq 344 aa
MEEDMYVDIFLDPYTFQDDFPPATSQLFSPGAPLDVHPLNPSNPETVFHSHLGAVKKAPS
DFSSVDLSFLPDELTQENKDRTVTGNKVTNEESFRTQDWQSQLQLPDEQGSGLNLNSNSS
PDTQSCLCSHDADSNQLSSETPNSNALPVVLISSMTPMNPVTECSGIVPQLQNVVSTANL
ACKLDLRKIALNAKNTEYNPKRFAAVIMRIREPRTTALIFSSGKVVCTGAKSEDESRLAA
RKYARVVQKLGFPVRFFNFKIQNMVASCDVKFPIRLEILALTHRQFSSYEPELFPGLIYK
MVKPQVVLLIFASGKVVLTGAKERSEIYEAFENMYPILESFKKV
NT seq 1035 nt   +upstreamnt  +downstreamnt
atggaggaggacatgtacgtggacattttcctggacccttataccttccaggatgacttt
cctccagctacgtctcaactattcagcccaggagcgcctttagatgtgcacccacttaat
ccatccaatccagagactgtatttcattcacatcttggtgcagtcaaaaaggcacccagt
gacttttcatctgtggatctaagcttcttaccagatgaacttacccaagaaaataaagac
cgaactgtcactggaaacaaagtcacaaatgaggaaagctttaggactcaagattggcaa
agtcagttgcagttgcctgatgaacaaggcagtgggctgaacttgaatagcaacagttca
ccagatacccagtcatgtctgtgctctcatgatgctgactccaaccagctctcttcagaa
acaccaaattccaatgccttacctgtggtattgatatcatccatgacaccaatgaaccct
gttacagaatgttctggaattgtgcctcaattacagaatgtagtttccactgcaaatctg
gcctgtaaattggatctgagaaaaatagctttgaatgccaaaaacacagaatataatcca
aagaggtttgctgcagtcataatgaggatccgagagccaaggaccacagctcttatattt
agctctgggaaagtggtctgtacaggagccaaaagtgaagacgagtctcggctggcagca
agaaagtatgctcgcgtggtgcagaagctggggttccccgtcagattcttcaattttaaa
attcagaacatggttgcaagctgtgatgtgaaatttcccatcaggctggagattttggca
ctaacccatcggcagttcagtagttatgagcctgaactgttccctggccttatttataag
atggtgaaaccgcaggttgtgctgctcatctttgcatctggaaaggttgtactgacaggt
gccaaagagcgttctgagatctacgaagcatttgaaaacatgtatcctattctagaaagt
tttaagaaagtctga

KEGG   Rattus norvegicus (rat): 689030
Entry
689030            CDS       T01003                                 

Gene name
Tbpl1
Definition
(RefSeq) TATA box-binding protein-like protein 1
  KO
K03120  transcription initiation factor TFIID TATA-box-binding protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03022  Basal transcription factors
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    689030 (Tbpl1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    689030 (Tbpl1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    689030 (Tbpl1)
   05165 Human papillomavirus infection
    689030 (Tbpl1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    689030 (Tbpl1)
   05017 Spinocerebellar ataxia
    689030 (Tbpl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    689030 (Tbpl1)
   03021 Transcription machinery [BR:rno03021]
    689030 (Tbpl1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   TATA-binding proteins
    689030 (Tbpl1)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     689030 (Tbpl1)
  RNA polymerase III system
    TFIIIB
     689030 (Tbpl1)
  RNA polymerase I system
    SL1/TIF-1B
     689030 (Tbpl1)
SSDB
Motif
Pfam: TBP DUF3378
Other DBs
NCBI-GeneID: 689030
NCBI-ProteinID: NP_001120673
RGD: 1597456
Ensembl: ENSRNOG00000011114
UniProt: D4A898
Position
1
AA seq 186 aa
MDADSDVALDILITNVVCVFRTRCHLNLRKIALEGANVIYKRDVGKVLMKLRKPRITATI
WSSGKIICTGATSEEEAKFGARRLARSLQKLGFQVIFTDFKVVNVLAVCNMPFEIRLPEF
TKNNRPHASYEPELHPAVCYRIKSLRATLQIFSTGSITVTGPNVKAVATAVEQIYPFVFE
SRKEIL
NT seq 561 nt   +upstreamnt  +downstreamnt
atggatgcagacagtgatgttgcattggacattttaattacaaatgtagtctgtgttttt
agaacaagatgccatttgaacttaaggaagattgctttggagggagcaaatgtaatttat
aagcgtgatgttgggaaagtattaatgaagcttagaaaacctagaattacagctacaatt
tggtcctcaggaaaaattatttgcactggagcaacgagtgaagaagaagctaaatttggt
gccagacgtttagcccgtagtctgcagaaactaggttttcaggtaatttttacagatttt
aaggttgtgaatgttttggcagtctgtaacatgccctttgaaatccgtttgccagaattc
acaaagaacaacagacctcatgccagctatgaacctgaacttcatcctgctgtgtgctat
cggataaagtctctaagagctacgttacagatattttcaacaggaagtatcacggtgaca
gggcccaatgtaaaggctgtggccacagccgtggagcagatctacccattcgtgtttgaa
agcaggaaggagattttgtaa

DBGET integrated database retrieval system