KEGG   Rattus norvegicus (rat): 117539
Entry
117539            CDS       T01003                                 

Gene name
Il10ra
Definition
(RefSeq) interleukin-10 receptor subunit alpha precursor
  KO
K05134  interleukin 10 receptor alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04630  JAK-STAT signaling pathway
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    117539 (Il10ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    117539 (Il10ra)
   04061 Viral protein interaction with cytokine and cytokine receptor
    117539 (Il10ra)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    117539 (Il10ra)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    117539 (Il10ra)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    117539 (Il10ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    117539 (Il10ra)
   04090 CD molecules [BR:rno04090]
    117539 (Il10ra)
Cytokine receptors [BR:rno04050]
 Interleukin receptor families
  IL10/28 receptor family
   117539 (Il10ra)
CD molecules [BR:rno04090]
 Proteins
  117539 (Il10ra)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 117539
NCBI-ProteinID: NP_476541
RGD: 620138
Ensembl: ENSRNOG00000016308
UniProt: G3V830
Position
8
AA seq 569 aa
MLPRLLPFLVSISSLSLGFRAHGTELPSPSSVWFEARFFQHILRWMSIPNQSESTYYEVA
LKKYGTSVWKDIHICSKAQTLSCDLTTSTLDLYHSSGYRARVRAVDNSQYSNWTITETRF
TVDEVILTVDSVTLKVSNGFIYGTIHPPRPNLVPVGDEYEQIFTHHRIYRVCIRKFSEQK
NITKTVEQENFTLEVPKGMRKFCVKVMPHVESRINKAEWSEEQCLHVTTEHYFTVTNLSI
FFLSILILCGALVCLVLLWYIRHPGKLPAVLVFEKPPDFLLANPRCPETLDDIHILDLEA
FPKVSPELKDSDLHGSTDSGFGSGKPSLQTEESQFFLLDSHAQIQETLGKEGSSELQDTC
GDNTDSGICLQESSLHSSMGPPWKQQFGYTHQDQDDSDLVQNSPGHPKHTQDGSALGHGC
LLEPEVPEEKDQVMVTFQGYQKQTRWKEEAAEPLDGEIPLAEAFDPELGVRLQGDSAWPP
VALATGYLKQESQGMASAPPGTPSRQWNQLAEECSLLGVVSCEDLSIESLGFAHELVPLD
CGAASSGLLDSLGTNLVTLPLISSLQIEE
NT seq 1710 nt   +upstreamnt  +downstreamnt
atgttgccgcgtttactcccattcctcgtctcgatctccagcctgagcctgggcttccgc
gcacacgggacagaactgccgagcccttcctccgtgtggtttgaagccagatttttccag
cacatcctccgctggatgtctatcccaaaccagtctgagagcacctactacgaagtggcc
ctcaagaagtacggaacctcggtctggaaagacatccacatctgtagcaaggctcagaca
ttgtcctgcgatctcacaacgtccaccctagatctgtaccacagctctggctaccgggcc
agagtccgggcagtggacaacagtcagtattccaactggaccatcactgaaactcgcttc
acagtggatgaagtgattctgacggtggatagcgtgacgctgaaagtaagcaacggcttc
atctacgggacaatccatccccccaggcccaatttagtccctgtaggtgacgagtatgaa
cagatcttcacgcaccaccgcatttacagggtttgcattcggaagttctcagaacaaaag
aatataaccaagacagtggagcaagaaaacttcaccctcgaagtcccaaaagggatgaga
aagttttgtgtcaaggtgatgcctcacgtggaatcccgaattaacaaggcagagtggtcg
gaggagcagtgtttacatgtcacgacggagcattatttcaccgtgaccaacctcagcatt
ttcttcttatccatcctgatactctgtggagccctggtctgcctggttctcctgtggtac
atccggcacccggggaagttacctgcagtcctggtcttcgagaagcctcccgactttctg
ctggccaaccctcgctgcccagagactctcgatgacattcacatcctggacctggaggcc
ttcccaaaggtgtcacccgagctgaaagactcagacctgcatggcagcaccgacagtggc
tttggcagtggcaaaccatcacttcagacggaagaatcccaattcttcctccttgactcc
cacgcccagatacaggagactctgggaaaggaagggtcttcagagctacaggacacctgt
ggggacaacacggacagtgggatctgcttgcaggagtccagcttacactctagcatgggt
cctccctggaagcagcagttcggatatacccaccaggaccaggatgacagtgacctagtc
cagaactctccagggcatcctaagcacacacaggatggctccgccttgggccatggttgt
ctcctagagcctgaagtccctgaggagaaagaccaagtcatggtaacgttccagggctac
cagaagcagaccagatggaaggaggaagcagcagaacctttggacggagagattcccttg
gcagaagcctttgatcctgaactcggggtgcgcctgcagggtgattcagcttggcctcct
gtggctctagccacgggttatttgaaacaggagtctcaagggatggcctctgctccaccg
gggacaccaagtagacagtggaatcaactggctgaggaatgctcactcctgggtgtggtt
agctgtgaagacctaagcatagagagtttgggttttgcccatgaacttgtccctctggac
tgtggggcagcctctagtggcctcctggatagccttggcactaatctggtcaccctgcca
ttgatctccagcctgcagatagaagagtga

KEGG   Rattus norvegicus (rat): 304091
Entry
304091            CDS       T01003                                 

Gene name
Il10rb
Definition
(RefSeq) interleukin-10 receptor subunit beta precursor
  KO
K05135  interleukin 10 receptor beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04630  JAK-STAT signaling pathway
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    304091 (Il10rb)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    304091 (Il10rb)
   04061 Viral protein interaction with cytokine and cytokine receptor
    304091 (Il10rb)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    304091 (Il10rb)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    304091 (Il10rb)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    304091 (Il10rb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    304091 (Il10rb)
   04090 CD molecules [BR:rno04090]
    304091 (Il10rb)
Cytokine receptors [BR:rno04050]
 Interleukin receptor families
  IL10/28 receptor family
   304091 (Il10rb)
CD molecules [BR:rno04090]
 Proteins
  304091 (Il10rb)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3 zf-MIZ
Other DBs
NCBI-GeneID: 304091
NCBI-ProteinID: NP_001100581
RGD: 1560373
Ensembl: ENSRNOG00000028638
UniProt: D3ZM36
Position
11
AA seq 351 aa
MAWAPSVAGWLGGFLLVPALGMIPPPENVRMNSVNFKNILQWEVPAFPKENLTFTAQYES
YWYFQDRCKNTASTHCDFSVLSKYGDHTVRVRTELADEHSEWVNVTFCPVEDTIIGPPEM
QTESLADSIHMRFSAPQIENEPETWTMKNIYNSWAYRVQYWKNGTKEKFQVTSQYDSEVL
RDLEPWTTYCIQVQGFLLDQNRTGEWSKPVCERTTSDETTPPWIVAIILIASVLIVFLFL
LGCFSMVWFIYKKTKYTFHSGTSLPQHLKEFLSHPHHSTFLLFSFPPPDETEVFDKLSII
TEESKSSKQNPEDNCASEPPSEAGPQELESKDEIPSPPQDDPPLLTSTSEV
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggcttgggcgccgagcgtggcgggctggctgggaggattcctcctggtgccagctcta
ggaatgattccacctcctgagaatgtcagaatgaattcagttaatttcaagaacattcta
cagtgggaggtgcctgctttccccaaagagaacctgactttcacagctcaatatgaaagt
tactggtacttccaagaccgctgcaagaacacggcctccacccactgcgacttctcggtt
ctttctaaatatggagaccacaccgtgagggtcaggactgagcttgcagatgaacattcg
gagtgggtaaacgtcaccttctgtcccgtggaagacaccattatcggacctcctgagatg
cagacagaatcccttgctgattcgatacacatgcgtttctcagccccacaaatagagaat
gagcctgagacatggaccatgaagaacatttataactcatgggcttacagggtacaatac
tggaaaaacgggactaaggagaagtttcaagtcacatctcagtatgactctgaggttctc
agagacctggagccatggacaacttactgcattcaagttcaagggtttcttctcgaccag
aacagaacgggagagtggagcaaacccgtctgtgaacggacaaccagtgatgaaacaacc
cctccctggatcgtggccatcatccttatagcctccgtcttgatagtcttcctcttccta
ctgggctgcttcagcatggtgtggttcatttacaagaagaccaagtacaccttccattct
gggacgtctcttccacagcacctcaaggagtttctgagtcacccccatcacagcactttt
ctgctgttctccttccctccccctgacgaaaccgaagtgttcgacaaactgagcatcatc
acggaagagtctaaaagcagcaagcagaaccctgaagacaactgtgcctcggaacccccg
tctgaggcagggcctcaggagctggagtccaaggatgaaatcccctcacctccacaggat
gaccctccactgctcacatctacctcagaagtgtga

DBGET integrated database retrieval system