KEGG   Rattus norvegicus (rat): 117543Help
Entry
117543            CDS       T01003                                 

Gene name
Decr1
Definition
(RefSeq) 2,4-dienoyl-CoA reductase 1
  KO
K13236  2,4-dienoyl-CoA reductase, mitochondrial [EC:1.3.1.34]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    117543 (Decr1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.34  2,4-dienoyl-CoA reductase (NADPH)
     117543 (Decr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR 3Beta_HSD
Motif
Other DBs
NCBI-GeneID: 117543
NCBI-ProteinID: NP_476545
RGD: 70999
Ensembl: ENSRNOG00000008236
UniProt: Q64591 G3V734
Position
5q13
AA seq 335 aa AA seqDB search
MALLARAFFAGVSRLPCDPGPQRFFSFGTKTLYQSIDAPQSKFFPPILKPMLPPNAFQGK
VAFITGGGTGLGKAMTTFLSSLGAQCVIASRNIDVLKATAEEITSKTGNKVYAIRCDVRD
PDMVHNTVLELIKVAGHPDVVINNAAGNFISPSERLSPNGWKTITDIVLNGTAYVTLEIG
KQLIKAQKGAAFLAITTIYAESGSGFVMPSSSAKSGVEAMNKSLAAEWGRYGMRFNIIQP
GPIKTKGAFSRLDPTGKFEKDMIERIPCGRLGTVEELANLATFLCSDYASWINGAVIRFD
GGEEVFLSGEFNSLKKVTKEEWDVIEGLIRKTKGS
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgctggcccgtgcgttctttgctggggtgtcccgcctcccctgcgatcccggt
cctcagaggtttttcagctttggaacgaaaaccctgtatcaaagcatcgatgctccacag
tctaaattcttcccacccattttaaagcctatgctaccacctaatgcctttcaaggaaaa
gtggctttcatcacgggaggaggcactggccttggcaaggcaatgacaactttcctgtcc
agcctgggtgcccagtgtgtgatcgcgagcaggaatattgatgttctgaaagctactgca
gaagagattacttctaaaactggaaataaggtctatgcgattcggtgtgacgttcgagat
cctgatatggtacacaacacagtactggagctgatcaaagttgcagggcatcctgatgtg
gtgataaacaatgcggcagggaacttcatttctcccagtgagagactgtctcccaatggt
tggaagaccataactgacatagttctcaatggtacagcctatgtgacgctagaaattgga
aagcagctaattaaagcacagaaaggagctgcctttcttgctatcactacgatctatgct
gagagcggatcaggctttgtaatgccaagttcttcagccaaatcaggcgtggaagccatg
aataagtctcttgcagctgaatggggtagatacggaatgcgtttcaacataattcagcca
gggcctatcaaaaccaaaggtgcctttagccgtttggacccgactggaaaatttgagaaa
gatatgatcgagagaatcccctgtggtcggctgggaactgtggaggaacttgccaatcta
gcgactttcctttgcagtgattatgcctcttggatcaatggggcagtcattcgatttgac
ggtggagaggaagtgtttctgtcaggtgaattcaactctctaaagaaggtcaccaaggag
gagtgggatgtaatcgaaggcctcatcagaaagacaaaaggctcctaa

DBGET integrated database retrieval system