KEGG   Rattus norvegicus (rat): 117544Help
Entry
117544            CDS       T01003                                 

Gene name
Ppat, Atase
Definition
(RefSeq) phosphoribosyl pyrophosphate amidotransferase
  KO
K00764  amidophosphoribosyltransferase [EC:2.4.2.14]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00250  Alanine, aspartate and glutamate metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    117544 (Ppat)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    117544 (Ppat)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rno01002]
    117544 (Ppat)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.14  amidophosphoribosyltransferase
     117544 (Ppat)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C44
   117544 (Ppat)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GATase_6 GATase_7 GATase_4 Pribosyltran PRTase_2
Motif
Other DBs
NCBI-GeneID: 117544
NCBI-ProteinID: NP_476546
RGD: 620237
Ensembl: ENSRNOG00000002128
UniProt: P35433
Position
14p11
AA seq 517 aa AA seqDB search
MELEESGIREECGVFGCIASGDWPTQLDVPHVITLGLVGLQHRGQESAGIVTSDGSSVPK
FRVHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKCELENCQPFVVETLHGKIAVA
HNGELVNAARLRKKLLRHGIGLSTSSDSEMITQLLAYTPPQEQDDTPDWVARIKNLMKEA
PAAYSLVIMHRDVIYAVRDPYGNRPLCIGRLMPVSDINDKEKKSSETEGWVVSSESCSFL
SIGARYCHEVKPGEIVEISRHGVRTLDIIPRSNGDPVAFCIFEYVYFARPDSMFEDQMVY
TVRYRCGQQLAVEAPVEADLVSTVPESATPAALGYATKCGLPYVEVLCKNRYVGRTFIQP
NMRLRQLGVAKKFGVLSDNFKGKRIVLIDDSIVRGNTISPIIKLLKESGAKEVHIRVASP
PIKHPCFMGINIPTKEELIANKPEFEYLAEYLGANSVVYLSVEGLVSSVQQEIKFKKQKV
KKRDITIQENGNGLEYFEKTGHCTACLTGQYPVDLEW
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggaactggaggagtcggggatccgtgaggaatgtggtgtgttcgggtgcatcgcttct
ggagactggcccacgcagctagatgtgccacatgtgatcactctgggactcgtggggctt
cagcaccgaggtcaggagagcgctggtattgtgaccagtgatgggagttcagtgcctaaa
ttcagggtgcataagggaatgggccttgtaaatcatgtttttaccgaagacaatttgaag
aaattgtatgtctcaaatcttggaatcggacatacgcggtacgccaccacagggaagtgt
gagctggaaaattgccagccgtttgttgttgagactctgcatgggaaaatagctgtggcc
cataacggagagctggtgaacgcagctcggctgaggaagaagcttctgcggcatggtatt
gggctttccacatcctccgatagtgaaatgattacccagttactcgcatatacccctcct
caggaacaagatgatactccagactgggtagcaagaattaagaacttaatgaaggaagcg
cccgcagcctactccctggtcataatgcacagggacgtcatttacgcagtgcgagatcca
tacggaaatcgtcctctatgcatcggccgtcttatgccagtttctgacataaatgacaaa
gagaaaaagtcttcagagactgaaggatgggtggtgtcctcagagtcttgcagcttttta
tctattggtgcgagatattgccatgaagtgaagcctggggaaattgtagaaatatccaga
catggtgtcagaactcttgatataattccaaggtctaatggagacccagtggctttttgt
atcttcgaatatgtttattttgcaagaccagatagtatgtttgaagaccagatggtttat
acggtaaggtaccggtgtggccagcagctggcagttgaagcaccagtggaggcggacctg
gtcagcacagttccagaatctgccacgcctgcggccctggggtatgcgacaaagtgtggg
ctgccatatgtggaggtgctgtgtaagaaccggtatgtaggaagaaccttcattcagcca
aacatgaggctaagacaacttggggttgcaaagaaattcggcgtgttgtctgacaacttt
aaaggcaaaagaattgttctcatagatgattccattgtgagaggcaatactatctcaccc
atcataaaactcctcaaagaatccggtgcaaaggaggtacacattcgagtcgcttcgcca
ccaataaaacatccgtgcttcatgggaataaacattcctacaaaagaagagcttatagcc
aataagcccgaatttgagtatcttgcagagtaccttggagcaaacagcgttgtgtatctg
tcagtggaaggactagtttcgtctgtgcaacaagaaataaagttcaagaagcagaaagtt
aaaaagcgtgatatcacaattcaagaaaatggaaatggtctggagtattttgagaagacg
ggacactgtacggcttgcctcactggccagtaccctgtggatctggaatggtag

DBGET integrated database retrieval system