KEGG   Rattus norvegicus (rat): 117548
Entry
117548            CDS       T01003                                 

Gene name
Kif1b
Definition
(RefSeq) kinesin family member 1B
  KO
K10392  kinesin family member 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    117548 (Kif1b)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     117548 (Kif1b)
SSDB
Motif
Pfam: Kinesin Kinesin_assoc DUF3694 Microtub_bd KIF1B PH FHA Yop-YscD_cpl PH_3 Tox-ODYAM1
Other DBs
NCBI-GeneID: 117548
NCBI-ProteinID: NP_476548
RGD: 621520
Ensembl: ENSRNOG00000057626
Vega: OTTRNOG00000000134
UniProt: O88658
Position
5q36
AA seq 1816 aa
MSGASVKVAVRVRPFNSRETSKESKCIIQMQGNSTSIINPKNPKEAPKSFSFDYSYWSHT
SPEDPCFASQSRVYNDIGKEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQEESQAGIIP
QLCEELFEKINDNCNEDMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVED
LSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQKKQDPETNLSTEK
VSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVDNCTSKSKKKKK
TDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIKCNAVI
NEDPNAKLVRELKEEVTRLKDLLRAQGLGDIIDIDPLMDDYSGSGGKYLKDFQNNKHRYL
LASENQRPGNFSTASMGSLTSSPSSCSLNSQAGLTSVTSIQERIMSTPGGEEAIERLKES
EKIIAELNETWEEKLRKTEAIRMEREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNED
PLMSECLLYYIKDGITRVGQADAERRQDIVLSGAHIKEEHCIFRSERNNTGEVIVTLEPC
ERSETYVNGKRVAHPVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPSEPVDWT
FAQRELLEKQGIDMKQEMEKRLQEMEILYKREKEEADLLLEQQRLDYESKLQALQKQVET
RSLAAETTEEEEEEEEVPWTQHEFELAQWAFRKWKSHQFTSLRDLLWGNAVYLKEANAIS
VELKKKVQFQFVLLTDTLYSPVPPELLPTEMGKTHEDRPFPRTVVAVEVQDLKNGATHYW
SLDKLKQRLDLMREMYDRAGEVGSNAQDDSETTMTGSDPFYDRFHWFKLVGSSPIFHGCV
NERLADRTPSPTFSTADSDITELADEQQDAMEDFDDEAFVDDTGSDAGTEEGSELFSDGH
DPFYDRSPWFILVGRAFVYLSNLLYPVPLIHRVAIVSEKGEVRGFLRVAVQAIAADEEAP
DYGSGIRQSGTAKISFDNEYFNQSDFPSAAMTRSGLSLEELRIVEGQGQSSEVISPPEEV
NRMNDLDLKSGTLLDGKMVMEGFSEEIGNHLKLGSAFTFRVTVLQASGILPEYADIFCQF
NFLHRHDEAFSTEPLKNNGRGSPLGFYHVQNIAVEVTESFVDYIKTKPIVFEVFGHYQQH
PLHLQGQELNSPPQPSRRFFPPPMPLSRPVPATKLNTMNKTSLGQSMSKYDLLVWFEISE
LEPTGEYIPAVVDHTAGLPCQGTFLLHQGIQRRITVTIIHEKGSELHWKDVRELVVGRIR
NKPEVDEAAVDAILSLNIISAKSLKSSHSSSRTFYRFEAVWDSSLHNSLLLNRVTPYGEK
IYMTLSAYLELDHCIQPAVITKDVCMVFYSRDAKISPPRSLRNLFGSGYSKSPDSNRVTG
IYELSLCKMADTGSPGMQRRRRKVLDTSVAYVRGEENLAGWRPRGDSLILEHQWELEKLE
LLHEVEKTRHFLLLRERLGDSIPKSMSDSLSPSLSSGTLSTSTSISSQISTTTFESAITP
SESSGYDSADIESLVDREKELATKCLQLLTHTFNREFSQVHGSISDCKLSDISPIGRDPS
VSSFSSSTLTPSSTCPSLVDSRSSSMDQKTPEANSRASSPCQEFEQFQIIPTVETPYLAR
AGKNEFLNLVPDIEEVRAGSVVSKKGYLHFKEPLSSNWAKHFVVVRRPYVFIYNSDKDPV
ERGIINLSTAQVEYSEDQQAMLKTPNTFAVCTKHRGVLLQALNDKDMNDWLYAFNPLLAG
TIRSKLSRRCPSQPKY
NT seq 5451 nt   +upstreamnt  +downstreamnt
atgtcgggagcctctgtgaaggtagccgttcgagtgaggcccttcaattcccgagagacc
agcaaggagtccaagtgcatcattcagatgcagggcaactcgaccagtattatcaaccca
aagaacccaaaggaagcaccaaagtccttcagctttgactactcttactggtctcacacc
tcgcctgaagacccctgctttgcatctcagagccgcgtgtacaatgacattgggaaggag
atgctcttgcatgccttcgaaggctataatgtctgtatctttgcctatgggcagaccggt
gctgggaaatcctacacgatgatggggaaacaagaagagagccaggccgggatcatccca
cagttgtgtgaagaactttttgagaagatcaatgacaactgtaatgaagatatgtcttac
tccgtggaggtgagctacatggaaatttactgtgagagagtacgagatttgctgaatccc
aaaaacaagggtaatttgcgtgtgcgtgaacacccacttctcggaccctatgtggaagat
ctgtccaagctggcagtcacttcctacactgacattgctgacctcatggatgctgggaac
aaagccaggacggtggcagctaccaacatgaacgagacgagtagccgttcccacgctgtg
tttaccattgtttttacccagaagaaacaggatcctgagacgaacctttctactgagaag
gtcagtaaaatcagcctggtggatctagcaggaagtgaacgagctgattcaactggcgcc
aaaggaactcgattaaaggaaggtgcaaatattaacaagtctcttacaactttgggcaaa
gtcatttcggccttggcagaggtggataactgcacaagcaagagtaaaaagaagaagaaa
actgattttattccttacagggattctgttcttacttggctccttcgagaaaatctaggt
ggcaactcccgaactgcaatggtggctgctctgagtcccgcagacatcaactatgatgaa
accttgagcacgctgagatatgcagatcgtgcaaaacagattaaatgcaacgctgttatc
aatgaggacccgaatgccaagctggttcgggagctgaaggaggaagtgacccgactgaag
gaccttctccgtgctcaggggctgggggacattatcgatattgatccattgatggatgat
tactctggaagtggaggcaaatatctgaaagattttcagaacaataagcataggtacttg
ctagcctctgagaatcaacgccctggcaatttctccacagcatccatggggtccctcact
tcatccccgtcttcatgctcacttaatagtcaggcgggcctaacctctgtgaccagtatt
caagagaggattatgtctacacctggaggggaggaagccattgaacgtctgaaggagtca
gagaagatcattgctgagttgaatgaaacctgggaagagaaacttcgtaaaacagaggcc
atcagaatggagagagaagccttgttggctgagatgggagttgccatacgggaagatggg
ggaacacttggcgttttctcacctaaaaagactccacaccttgttaacctcaatgaagac
cctctaatgtcggagtgtttgctttattatatcaaggacggaattacaagggttggccaa
gcagatgctgagcggcgccaggacatcgtgctgagtggggcccacattaaagaagagcat
tgtatctttcggagtgagagaaacaacactggcgaagttattgtgaccttagagccctgt
gagcgctcagaaacctatgtgaatggcaagagggtggcccatcctgttcagctgcgctca
gggaaccgtatcatcatgggtaaaaatcatgttttccgctttaaccaccctgagcaagct
cgagcagagcgggagaagactccctctgctgagaccccctctgagcctgtggattggaca
tttgctcagagagaacttcttgaaaaacaagggattgatatgaaacaggagatggagaaa
aggcttcaggaaatggagatcctttacaaaagggagaaggaggaagctgaccttcttctg
gagcagcagaggctggactatgagagtaaattgcaggccttgcagaagcaggttgagact
cgatctctggctgcagagaccacggaagaggaagaggaggaggaggaagttccttggaca
cagcatgaatttgagttggcccagtgggcgttccggaaatggaagtctcaccagtttact
tcgttaagggacttactctggggcaatgcggtgtacctgaaggaagccaatgccatcagt
gtggaactgaagaaaaaggtgcagttccagttcgttctgctgactgacacactatactcc
cctgtgcctcccgaactgcttcccacggagatggggaaaacccacgaggacaggcctttc
cctcggacagtggtggctgtggaagtccaggacctgaagaatggagcaacacattattgg
tctttggataagctcaagcagagactggatctaatgcgagagatgtatgacagggcaggt
gaggtgggctccaatgcccaagacgacagcgagacgaccatgacaggcagcgacccgttt
tacgatcggttccactggttcaaacttgtgggaagctcccctattttccacggctgtgtg
aatgagcgccttgccgaccgcacaccctcccccactttttccacggccgattccgacatc
actgaactggctgacgagcagcaggatgccatggaggactttgatgatgaggccttcgtg
gatgacaccggctctgacgcagggacggaggagggatcagagctcttcagtgatgggcat
gacccattttacgaccgatccccttggttcattttagtaggaagggcatttgtgtacttg
agcaacctgctgtatccagtgcccctgattcacagggtggccatcgtcagtgagaagggg
gaagtgcggggcttccttcgagtggctgtgcaggccattgcagcggatgaagaagctcct
gattatggctctggaattcgacagtcaggaacagctaaaatatcttttgataatgagtac
tttaatcagagtgacttcccttcagctgcaatgactcgttctggtctgtccttggaggag
ctgaggattgttgagggacagggccagagttctgaagtcatcagtcctccagaagaagtc
aatcgaatgaatgacttggatttgaagtcgggcactctgctggacgggaagatggtgatg
gaaggattttccgaagagattggtaaccacctgaaactgggcagtgcgttcactttccga
gtcactgtgctccaggccagtggcatcctgccggagtatgcagacatcttttgtcagttc
aactttttgcatcggcatgacgaagcgttctccactgaacccctgaagaacaacggaaga
ggaagtcccctgggcttttaccatgtacagaatattgcagtggaggtcaccgagtcattt
gtggactacatcaaaaccaaacccatcgtgtttgaggtcttcgggcattaccagcagcac
ccacttcatctgcaaggacaagagcttaacagtccacctcagccatctcgaagattcttc
cccccacccatgccactctccagaccagttccagccactaagttaaacaccatgaacaaa
accagccttgggcaaagcatgagcaagtacgaccttctggtttggtttgagatcagtgaa
ctggagcctactggagagtatattccagctgtggttgaccatacagcaggcttgccctgc
caggggacatttttgctgcaccagggcatccagcgacggatcacagtgactattatccat
gagaagggcagtgagctccactggaaagatgtccgtgagctggtggtaggtcggattagg
aataaacctgaggtggatgaagctgcagttgatgctatcctttccctaaacatcatctct
gctaagtccctcaagtcttctcacagctccagcaggaccttctaccgctttgaggctgta
tgggacagctccctacataactccctccttctgaaccgagtgacaccctatggagaaaag
atctacatgaccttatctgcttatctggagttggatcattgcatccagccagccgtcatc
actaaggatgtgtgcatggtcttctattcccgagatgccaagatctcaccaccacgttct
ctgagaaacctctttggtagtggctactcaaagtcaccagactccaaccgagtaactgga
atctacgagcttagcttatgcaaaatggcagatactgggagcccaggcatgcagaggcgg
aggagaaaagtcttggatacctcggtggcgtatgttcggggagaggagaacctcgcaggc
tggcgacctcgtggagacagcctcatcctggaacaccaatgggagctggagaagctggag
cttctgcatgaggtggaaaaaactcgccacttcttgctgcttcgggagagacttggtgac
agcatacccaagtctatgagtgactcactgtcccccagcctcagcagtggaacccttagc
acctcgaccagcatctcttctcagatctcaaccactacctttgaaagcgccatcacaccg
agcgagagcagtggctacgactcagcagacattgaaagcctggtagaccgagagaaagaa
ctggctacaaagtgcctgcagcttctcacccacactttcaaccgagaattcagccaggta
catggcagcatcagtgactgtaagttgtctgacatctctccgattggacgcgacccctcg
gtgtccagtttcagcagttccaccctcacgccctcctccacatgcccctccctggtggac
tccaggagcagctctatggatcagaagaccccagaagccaactctcgtgcgtctagtcct
tgccaggaatttgaacagtttcagatcatcccaactgtggagacaccctatttggcccga
gcaggaaagaatgaatttctcaatcttgttccagacattgaagaagttagagcaggctca
gtggtgtctaagaaaggatacctgcatttcaaagagccactctccagtaactgggctaaa
catttcgttgtggttcgtcgcccttacgtcttcatctataacagtgacaaagacccagta
gagcgtggcatcattaacctgtccacagcacaggtggagtacagcgaggaccagcaggcc
atgctgaagacacctaacacttttgctgtgtgcacaaagcaccgtggggtccttctgcaa
gctctcaatgacaaagacatgaatgactggttatacgcctttaacccactcctggctggc
acaataaggtcaaaactctctcgcagatgcccaagccagccaaaatactaa

DBGET integrated database retrieval system