KEGG   Rattus norvegicus (rat): 117550Help
Entry
117550            CDS       T01003                                 

Gene name
Kif5b, Khc
Definition
(RefSeq) kinesin family member 5B
  KO
K10396  kinesin family member 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04728  Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    117550 (Kif5b)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    117550 (Kif5b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    117550 (Kif5b)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    117550 (Kif5b)
   04147 Exosome [BR:rno04147]
    117550 (Kif5b)
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Others
    117550 (Kif5b)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     117550 (Kif5b)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   117550 (Kif5b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinesin Microtub_bd DUF4226
Motif
Other DBs
NCBI-GeneID: 117550
NCBI-ProteinID: NP_476550
RGD: 621559
Ensembl: ENSRNOG00000017466
UniProt: Q2PQA9
Structure
PDB: 

Position
17q12.1
AA seq 963 aa AA seqDB search
MADPAECNIKVMCRFRPLNESEVNRGDKYVAKFQGEDTVMIASKPYAFDRVFQSSTSQEQ
VYNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPEGMGIIPRIVQDIFNYIY
SMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLSVHEDKNRVPYVKGCTERFVCSPDEVM
DTIDEGKSNRHVAVTNMNEHSSRSHSIFLINVKQENTQTEQKLSGKLYLVDLAGSEKVSK
TGAEGAVLDEAKNINKSLSALGNVISALAEGSTYVPYRDSKMTRILQDSLGGNCRTTIVI
CCSPSSYNESETKSTLLFGQRAKTIKNTVCVNVELTAEQWKKKYEKEKEKNKTLRNTIQW
LENELNRWRNGETVPIDEQFDKEKANLEAFTADKDVAITNDKPAAAIGMAGSFTDAERRK
CEEEIAKLYKQLDDKDEEINQQSQLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAE
NDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKL
KEMTNHQKKRAAEMMASLLKDLAEIGIAVGNNDVKQPEGTGMIDEEFTVARLYISKMKSE
VKTMVKRCKQLESTQTESNKKMEENEKELAACQLRISQHEAKIKSLTEYLQNVEQKKRQL
EESVDSLGEELVQLRAQEKVHEMEKEHLNKVQTANEVKQAVEQQIQSHRETHQKQISSLR
DEVEAKEKLITDLQDQNQKMVLEQERLRVEHERLKAVDQEKSRKLHELTVMQDRREQARQ
DLKGLEETVAKELQTLHNLRKLFVQDLATRVKKSAEVDSDDTGGSAAQKQKISFLENNLE
QLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENASRDRKRYQQEVD
RIKEAVRSKNMARRGHSAQIAKPIRPGQHPAASPTHPGAVRGGGSFVQNNQPVGLRGGGG
KQA
NT seq 2892 nt NT seq  +upstreamnt  +downstreamnt
atggcggacccggcggagtgcaacatcaaagtgatgtgtcgcttcagacctctcaacgag
tctgaagtgaaccgcggcgacaagtatgtcgccaagttccagggagaagacacggtgatg
attgcgtccaagccttatgcatttgatcgtgtgttccagtcaagcacatctcaagagcaa
gtatacaacgattgtgcaaagaagattgttaaagatgttcttgagggctataatggaaca
atatttgcatatggacaaacatcatctggaaagacccacacaatggagggtaaacttcat
gatccagaaggcatggggattattccaagaatagtgcaagatatttttaattatatttac
tccatggatgaaaatttggaatttcatattaaggtttcatattttgaaatatatttggat
aagataagggacctgttagatgtttcaaagactaacctttcagtccatgaagacaaaaac
cgtgttccctatgtaaaggggtgcacagagcgttttgtgtgtagtccagatgaagttatg
gataccatagatgaagggaaatccaacagacacgtagcagttacaaatatgaatgaacat
agctctaggagtcacagtatatttcttatcaatgtaaagcaagagaatacacagacagaa
cagaaactcagtgggaagctttatctggttgatttagctggaagtgaaaaggttagtaaa
actggagctgagggtgccgtgctggatgaagctaagaacatcaacaagtcactttctgca
cttggaaatgtcatttctgctttggcagaaggcagtacctatgttccttatcgagacagt
aaaatgaccagaattcttcaagattcattaggtggcaactgtaggaccactattgtcatt
tgctgctctccgtcatcttacaatgagtctgagacaaagtcaacactcctctttggtcaa
agggccaaaacaataaagaacacagtctgtgtcaacgtagagttaactgcagagcagtgg
aaaaagaagtatgaaaaagaaaaggaaaaaaataagactctacggaacaccattcagtgg
ctggaaaacgagctcaaccgatggcgtaacggggaaacagtgcctattgatgagcagttt
gacaaagagaaggctaatttggaagccttcacagcagataaagatgttgctattaccaat
gacaaaccggctgctgcaatcggaatggctggtagttttacagatgctgagagaagaaag
tgtgaagaagaaattgctaaattgtataaacaacttgatgacaaggatgaagagattaac
caacagagccaactggtggagaaattgaagacacaaatgttggatcaggaagagcttctg
gcatcaaccagaagggatcaagataatatgcaagctgaactgaatcgcctccaagcagaa
aatgatgcttctaaagaagaagtcaaagaagttttacaggccttagaggagctggctgtt
aattatgatcagaagtctcaggaagttgaagacaaaacaaaggaatatgaattgcttagt
gatgaattgaatcaaaaatctgcaactttagcaagtattgatgctgagcttcagaagctg
aaggaaatgaccaaccaccagaagaaacgagcagctgaaatgatggcatcattactaaaa
gaccttgcagaaataggaattgctgtgggaaataatgatgtaaagcaaccggaggggact
ggtatgatagatgaagagtttactgttgcaaggctctacattagcaaaatgaaatcagaa
gtaaaaaccatggtgaaacgctgcaaacagctagaaagcacacagactgagagcaacaaa
aaaatggaagaaaatgagaaggagttagcagcatgccagcttcgtatctcccaacatgaa
gccaaaatcaagtcactgactgaataccttcaaaatgtagaacaaaagaagagacagctg
gaggaatctgtggactcccttggtgaggagctagtccaacttcgagcacaagagaaagtc
catgaaatggaaaaagagcacttgaacaaggttcagactgcaaatgaagtcaagcaagct
gttgaacagcagatccagagtcacagagaaacccaccaaaaacaaatcagtagtttacga
gatgaagttgaggcaaaggaaaagctaatcactgatctccaagaccaaaaccagaagatg
gtgttggaacaggagcggctaagggtggagcatgagaggctaaaggctgtagaccaggag
aagagcaggaagctgcatgagctcacggttatgcaagacagacgagaacaagcaaggcaa
gatttgaaggggttggaagagacggtggcaaaagaacttcagactttacacaacctgcgc
aagctctttgttcaggacttggctaccagggtgaaaaagagcgctgaggtggactcagac
gacactggcggcagtgctgcacagaagcagaaaatctccttccttgaaaacaatctggag
cagctcaccaaagtgcacaagcagttggtgcgtgataatgcagatcttcgctgtgaactt
cctaagttagagaaacgacttagagctactgcagagagagtgaaagctttggagtcagcc
ctgaaagaagccaaagaaaatgcatctcgagaccgcaaacgctatcagcaagaagtagac
aggataaaggaagcagtcaggtcaaagaatatggccagaaggggacactctgcacagatt
gcaaaacctatccgtcctggacagcatccagcagcctctccaactcaccccggtgcagtt
cgtggaggaggctcatttgttcagaacaaccagccagtggggcttcgaggtggtggaggc
aagcaggcgtga

DBGET integrated database retrieval system