KEGG   Rattus norvegicus (rat): 117550
Entry
117550            CDS       T01003                                 

Gene name
Kif5b
Definition
(RefSeq) kinesin-1 heavy chain
  KO
K10396  kinesin family member 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04728  Dopaminergic synapse
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
rno05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    117550 (Kif5b)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    117550 (Kif5b)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    117550 (Kif5b)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    117550 (Kif5b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    117550 (Kif5b)
   05012 Parkinson disease
    117550 (Kif5b)
   05014 Amyotrophic lateral sclerosis
    117550 (Kif5b)
   05016 Huntington disease
    117550 (Kif5b)
   05020 Prion disease
    117550 (Kif5b)
   05022 Pathways of neurodegeneration - multiple diseases
    117550 (Kif5b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    117550 (Kif5b)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    117550 (Kif5b)
   04147 Exosome [BR:rno04147]
    117550 (Kif5b)
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Others
    117550 (Kif5b)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     117550 (Kif5b)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   117550 (Kif5b)
SSDB
Motif
Pfam: Kinesin Microtub_bd
Other DBs
NCBI-GeneID: 117550
NCBI-ProteinID: NP_476550
RGD: 621559
Ensembl: ENSRNOG00000017466
UniProt: Q2PQA9
Structure
PDB: 
4ATX

Position
17
AA seq 963 aa
MADPAECNIKVMCRFRPLNESEVNRGDKYVAKFQGEDTVMIASKPYAFDRVFQSSTSQEQ
VYNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPEGMGIIPRIVQDIFNYIY
SMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLSVHEDKNRVPYVKGCTERFVCSPDEVM
DTIDEGKSNRHVAVTNMNEHSSRSHSIFLINVKQENTQTEQKLSGKLYLVDLAGSEKVSK
TGAEGAVLDEAKNINKSLSALGNVISALAEGSTYVPYRDSKMTRILQDSLGGNCRTTIVI
CCSPSSYNESETKSTLLFGQRAKTIKNTVCVNVELTAEQWKKKYEKEKEKNKTLRNTIQW
LENELNRWRNGETVPIDEQFDKEKANLEAFTADKDVAITNDKPAAAIGMAGSFTDAERRK
CEEEIAKLYKQLDDKDEEINQQSQLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAE
NDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKL
KEMTNHQKKRAAEMMASLLKDLAEIGIAVGNNDVKQPEGTGMIDEEFTVARLYISKMKSE
VKTMVKRCKQLESTQTESNKKMEENEKELAACQLRISQHEAKIKSLTEYLQNVEQKKRQL
EESVDSLGEELVQLRAQEKVHEMEKEHLNKVQTANEVKQAVEQQIQSHRETHQKQISSLR
DEVEAKEKLITDLQDQNQKMVLEQERLRVEHERLKAVDQEKSRKLHELTVMQDRREQARQ
DLKGLEETVAKELQTLHNLRKLFVQDLATRVKKSAEVDSDDTGGSAAQKQKISFLENNLE
QLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENASRDRKRYQQEVD
RIKEAVRSKNMARRGHSAQIAKPIRPGQHPAASPTHPGAVRGGGSFVQNNQPVGLRGGGG
KQA
NT seq 2892 nt   +upstreamnt  +downstreamnt
atggcggacccggcggagtgcaacatcaaagtgatgtgtcgcttcagacctctcaacgag
tctgaagtgaaccgcggcgacaagtatgtcgccaagttccagggagaagacacggtgatg
attgcgtccaagccttatgcatttgatcgtgtgttccagtcaagcacatctcaagagcaa
gtatacaacgattgtgcaaagaagattgttaaagatgttcttgagggctataatggaaca
atatttgcatatggacaaacatcatctggaaagacccacacaatggagggtaaacttcat
gatccagaaggcatggggattattccaagaatagtgcaagatatttttaattatatttac
tccatggatgaaaatttggaatttcatattaaggtttcatattttgaaatatatttggat
aagataagggacctgttagatgtttcaaagactaacctttcagtccatgaagacaaaaac
cgtgttccctatgtaaaggggtgcacagagcgttttgtgtgtagtccagatgaagttatg
gataccatagatgaagggaaatccaacagacacgtagcagttacaaatatgaatgaacat
agctctaggagtcacagtatatttcttatcaatgtaaagcaagagaatacacagacagaa
cagaaactcagtgggaagctttatctggttgatttagctggaagtgaaaaggttagtaaa
actggagctgagggtgccgtgctggatgaagctaagaacatcaacaagtcactttctgca
cttggaaatgtcatttctgctttggcagaaggcagtacctatgttccttatcgagacagt
aaaatgaccagaattcttcaagattcattaggtggcaactgtaggaccactattgtcatt
tgctgctctccgtcatcttacaatgagtctgagacaaagtcaacactcctctttggtcaa
agggccaaaacaataaagaacacagtctgtgtcaacgtagagttaactgcagagcagtgg
aaaaagaagtatgaaaaagaaaaggaaaaaaataagactctacggaacaccattcagtgg
ctggaaaacgagctcaaccgatggcgtaacggggaaacagtgcctattgatgagcagttt
gacaaagagaaggctaatttggaagccttcacagcagataaagatgttgctattaccaat
gacaaaccggctgctgcaatcggaatggctggtagttttacagatgctgagagaagaaag
tgtgaagaagaaattgctaaattgtataaacaacttgatgacaaggatgaagagattaac
caacagagccaactggtggagaaattgaagacacaaatgttggatcaggaagagcttctg
gcatcaaccagaagggatcaagataatatgcaagctgaactgaatcgcctccaagcagaa
aatgatgcttctaaagaagaagtcaaagaagttttacaggccttagaggagctggctgtt
aattatgatcagaagtctcaggaagttgaagacaaaacaaaggaatatgaattgcttagt
gatgaattgaatcaaaaatctgcaactttagcaagtattgatgctgagcttcagaagctg
aaggaaatgaccaaccaccagaagaaacgagcagctgaaatgatggcatcattactaaaa
gaccttgcagaaataggaattgctgtgggaaataatgatgtaaagcaaccggaggggact
ggtatgatagatgaagagtttactgttgcaaggctctacattagcaaaatgaaatcagaa
gtaaaaaccatggtgaaacgctgcaaacagctagaaagcacacagactgagagcaacaaa
aaaatggaagaaaatgagaaggagttagcagcatgccagcttcgtatctcccaacatgaa
gccaaaatcaagtcactgactgaataccttcaaaatgtagaacaaaagaagagacagctg
gaggaatctgtggactcccttggtgaggagctagtccaacttcgagcacaagagaaagtc
catgaaatggaaaaagagcacttgaacaaggttcagactgcaaatgaagtcaagcaagct
gttgaacagcagatccagagtcacagagaaacccaccaaaaacaaatcagtagtttacga
gatgaagttgaggcaaaggaaaagctaatcactgatctccaagaccaaaaccagaagatg
gtgttggaacaggagcggctaagggtggagcatgagaggctaaaggctgtagaccaggag
aagagcaggaagctgcatgagctcacggttatgcaagacagacgagaacaagcaaggcaa
gatttgaaggggttggaagagacggtggcaaaagaacttcagactttacacaacctgcgc
aagctctttgttcaggacttggctaccagggtgaaaaagagcgctgaggtggactcagac
gacactggcggcagtgctgcacagaagcagaaaatctccttccttgaaaacaatctggag
cagctcaccaaagtgcacaagcagttggtgcgtgataatgcagatcttcgctgtgaactt
cctaagttagagaaacgacttagagctactgcagagagagtgaaagctttggagtcagcc
ctgaaagaagccaaagaaaatgcatctcgagaccgcaaacgctatcagcaagaagtagac
aggataaaggaagcagtcaggtcaaagaatatggccagaaggggacactctgcacagatt
gcaaaacctatccgtcctggacagcatccagcagcctctccaactcaccccggtgcagtt
cgtggaggaggctcatttgttcagaacaaccagccagtggggcttcgaggtggtggaggc
aagcaggcgtga

KEGG   Rattus norvegicus (rat): 171041
Entry
171041            CDS       T01003                                 

Gene name
Klc1
Definition
(RefSeq) kinesin light chain 1 isoform C
  KO
K10407  kinesin light chain
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    171041 (Klc1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    171041 (Klc1)
   05012 Parkinson disease
    171041 (Klc1)
   05014 Amyotrophic lateral sclerosis
    171041 (Klc1)
   05016 Huntington disease
    171041 (Klc1)
   05020 Prion disease
    171041 (Klc1)
   05022 Pathways of neurodegeneration - multiple diseases
    171041 (Klc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    171041 (Klc1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    171041 (Klc1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     171041 (Klc1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     171041 (Klc1)
SSDB
Motif
Pfam: TPR_12 TPR_10 TPR_7 TPR_1 TPR_2 TPR_16 TPR_8 TPR_19 TPR_MalT TPR_17 ANAPC3 PPR RNPP_C JIP_LZII GlfT2_domain3 GHL5 COG2
Other DBs
NCBI-GeneID: 171041
NCBI-ProteinID: NP_001075443
RGD: 621411
Ensembl: ENSRNOG00000011572
Vega: OTTRNOG00000002307
UniProt: P37285
Position
6
AA seq 560 aa
MHDNMSTMVYMKEEKLEKLTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDD
ESNLVEEKSSMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWL
RDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKDSDSSKEPLDDLF
PNDEDDPGQGIQQQHSSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQAL
EDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGRDHPAVAATL
NNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEY
YYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVD
DENKPIWMHAEEREECKGKQKDGSSFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKF
EAAETLEEAALRSRKQGLDNVHKQRVAEVLNDPENVEKRRSRESLNVDVVKYESGPDGGE
EVSMSVEWNGMRKMKLGLVK
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgcatgacaacatgtccacaatggtgtacatgaaggaagagaagctggagaagcttacg
caggatgaaatcatttctaagaccaagcaggtgatccaggggctggaggccctgaagaat
gagcacaactccatcctgcagagtctgctggagacgctgaagtgcttgaagaaggacgat
gagagcaacctggtggaggagaagtccagcatgatccgcaagtccttggagatgctggag
ctcggcctgagcgaggcgcaggtgatgatggccctgtctaatcacctgaatgccgtggag
tccgagaagcagaagctccgagctcaggttcgacgtctgtgccaggagaaccagtggctg
cgggatgaactggccaacacacagcagaagttacagaagagcgagcagtccgtggctcag
ctggaggaggagaagaagcacctggagttcatgaaccagctgaagaaatacgacgacgac
atctctccctcggaagacaaagactctgattcttccaaagagccgttggatgacctcttc
ccgaatgatgaggatgacccaggacaaggaatccagcagcaacacagcagtgctgcggcc
gccgcccagcagggcggctacgagatccctgcccggctgcgcacgctccacaacctggtg
atccagtatgcctcgcaggggcgttacgaggtggcggtgccactctgcaagcaggccctg
gaggacctggagaagacttccggccacgaccaccctgatgtggccaccatgctcaacatc
ctggccctggtgtacagggatcagaacaagtataaagacgcagcaaacctcctgaacgat
gccctggctatccgtgagaaaaccctgggccgagatcaccctgcggtggctgcgaccctc
aacaacctagcagtgctgtacggtaagcgtggcaagtacaaagaggccgagccgctgtgc
aaacgggccctggagatcagggagaaggttctgggaaaggatcaccctgatgttgctaag
caactaaataatctggccttgctgtgccagaaccagggcaagtacgaggaggtggagtat
tactaccagagggccctggagatctaccagacgaagctcggacccgatgatcccaacgtg
gccaagacgaagaataacctggcttcctgttatctgaaacaagggaagttcaaacaagca
gaaacattgtacaaggagattctcacccgcgcacatgaacgggagtttggatctgtggat
gatgaaaacaagcccatatggatgcacgcggaggagagagaggagtgcaaaggaaagcag
aaggacgggtcgtcttttggagagtatggcggctggtataaggcctgcaaagtggacagt
cccaccgtcacaaccaccttgaaaaacctgggagcactttaccgccgccaggggaagttt
gaagctgcggagacactggaggaagctgccctgaggtcacgtaagcagggtcttgacaat
gttcacaaacagagagtggctgaagtgctaaatgaccctgagaacgtggagaagcggagg
agccgggagagcctcaatgtggacgtggtcaagtacgagagtggccctgacggaggggag
gaagtgagtatgagcgtagagtggaatgggatgagaaagatgaagctcgggctggttaaa
tga

KEGG   Rattus norvegicus (rat): 171549
Entry
171549            CDS       T01003                                 

Gene name
Klc3
Definition
(RefSeq) kinesin light chain 3
  KO
K10407  kinesin light chain
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    171549 (Klc3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    171549 (Klc3)
   05012 Parkinson disease
    171549 (Klc3)
   05014 Amyotrophic lateral sclerosis
    171549 (Klc3)
   05016 Huntington disease
    171549 (Klc3)
   05020 Prion disease
    171549 (Klc3)
   05022 Pathways of neurodegeneration - multiple diseases
    171549 (Klc3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    171549 (Klc3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    171549 (Klc3)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     171549 (Klc3)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     171549 (Klc3)
SSDB
Motif
Pfam: TPR_12 TPR_10 TPR_7 TPR_1 TPR_2 TPR_19 TPR_8 TPR_MalT TPR_16 TPR_17 ANAPC3 SNAP PPR PPR_2 RNPP_C YabA Tox-GHH TPR_11 TMF_TATA_bd
Other DBs
NCBI-GeneID: 171549
NCBI-ProteinID: NP_612529
RGD: 621432
Ensembl: ENSRNOG00000018101
UniProt: Q68G30
Position
1
AA seq 505 aa
MSVQVAAPGSTGLGPERLNPEELVRQTRQVVQGLEALRAEHHSLAGHLAEALAGPGPVAG
VELLEEKQQVVNHSLEAIELGLGEAQVLLALSAHVGVLEAEKQRLRAQARRLAQENTWLR
EELEETQRRLRASEEAVAQLEEEKSHLQFLGQLRQYDPPEESQRPDSPPRRDSLASLFPS
EEEEKKGPEAAGAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCRQALEDLERS
SGHCHPDVATMLNILALVYRDQNKYKEATELLHDALQIREQTLGPEHPAVAATLNNLAVL
YGKRGRYREAEPLCQRALEIREKVLGADHPDVAKQLNNLALLCQNQGKFQDVERHYARAL
SIYEALGGPQDPNVAKTKNNLASAYLKQNKYQQAEELYKEILSQEALPAPLGAPQGGTAG
EAQQQVLRRSSSFSKLRESIRRGSEKLVSRLRGESMAGAAGMKRAMSLNMLNVDGPRAAR
MQLSTQHLNEASRTLSASTQDLSPR
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgtctgtgcaggtggcagcccctggaagcacagggctgggcccagaacgcctgaacccg
gaggagctggtgcggcagacgcgacaggttgtacagggactggaggccctgcgggccgag
caccatagtctggctgggcacttggcggaggccctggctggaccaggccctgtagcgggt
gtagaactgctggaagagaagcaacaggtggtgaaccactccctggaggccattgagctg
ggactgggtgaggcccaggtgctgctggccctgtctgcacacgtgggtgtgttggaggct
gagaagcagaggctacgggcacaggcacggaggctagcccaagagaacacatggcttcga
gaggagctggaggagacacagaggcgactgcgggccagtgaggaggctgtggcccagctg
gaagaggagaaaagccaccttcagttcctggggcagctgaggcagtatgacccgcccgag
gagagccagaggccggattccccgcctcgccgagacagcctggcttctctcttccccagt
gaagaggaggaaaagaaaggtcctgaggcagcaggagcagcagcagcgcagcagggtggc
tatgagatcccagctcgtctgcggactctgcacaacctggtgatccagtatgctagccag
ggccgctatgaggtggcagttccgctgtgtcgccaggccttggaggacctggagcggagc
tcaggccactgccaccctgacgtggccaccatgctcaacatcctggcacttgtgtacagg
gaccagaacaagtacaaggaggccacggagcttcttcacgacgccctgcagatccgggaa
cagacgctgggtcctgaacaccctgcagtggccgccaccctcaacaacctggcagtcctt
tacggaaaacgtggccgttaccgggaggcagaacccctctgccagcgtgctctggagatc
cgtgagaaggtcctgggtgctgaccaccctgatgtggccaagcagctcaacaacctggcc
ctgctgtgccagaaccagggcaagtttcaggatgtggagcggcactatgcaagggccctg
agtatctacgaggccctggggggaccacaagacccaaatgtggctaagaccaagaacaac
ctggcctcggcctacctgaagcagaacaagtatcagcaggcagaggagctatacaaggag
atcctcagccaggaggccctgcctgccccgcttggagccccccagggaggcacagcaggt
gaagcacaacagcaggtcctacgcaggagcagttccttctctaagctcagagagtccatc
cggcgtggaagtgagaagctggtctcccgcctccgaggggagagcatggcaggggctgca
gggatgaagagagccatgtcactcaatatgctgaacgtcgatggtccaagggctgccagg
atgcagctctcaacccagcacctgaatgaggcctctcggaccctcagcgccagcacgcag
gatttgagcccgcgctaa

KEGG   Rattus norvegicus (rat): 309159
Entry
309159            CDS       T01003                                 

Gene name
Klc2
Definition
(RefSeq) kinesin light chain 2
  KO
K10407  kinesin light chain
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    309159 (Klc2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    309159 (Klc2)
   05012 Parkinson disease
    309159 (Klc2)
   05014 Amyotrophic lateral sclerosis
    309159 (Klc2)
   05016 Huntington disease
    309159 (Klc2)
   05020 Prion disease
    309159 (Klc2)
   05022 Pathways of neurodegeneration - multiple diseases
    309159 (Klc2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    309159 (Klc2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    309159 (Klc2)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     309159 (Klc2)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     309159 (Klc2)
SSDB
Motif
Pfam: TPR_12 TPR_10 TPR_7 TPR_1 TPR_2 TPR_MalT TPR_16 TPR_8 TPR_19 TPR_17 ANAPC3 SNAP PPR JIP_LZII Crescentin DUF627 TMF_TATA_bd YabA TMF_DNA_bd Csm1_N KASH_CCD NUDE_C ATG16 COG2
Other DBs
NCBI-GeneID: 309159
NCBI-ProteinID: NP_001359013
RGD: 1307377
Ensembl: ENSRNOG00000020299
Position
1
AA seq 622 aa
MATMVLPREEKLSQDEIVLGTKAVIQGLETLRGEHRALLAPLASHEAGEAEPGSQERCLL
LRRSLEAIELGLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKL
QRSEQAVAQLEEEKQHLLFMSQIRKLDEDASPNEEKGDVPKDSLDDLFPNEDEQSPAPSP
GGGDVAAQHGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVA
TMLNILALVYRDQNKYKDAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKE
AEPLCKRALEIREKVLGKFHPDVAKQLSNLALLCQNQGKAEEVEYYYRRALEIYATRLGP
DDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFGSVNGENKPIWMHAEEREE
SKDKRRDSAPYGEYGSWYKACKVDSPTVNTTLRSLGALYRRQGKLEAAHTLEDCASRSRK
QGLDPASQTKVVELLKDGSGGRGDRRGSRDVAGGAGPRSESDLEESGPAAEWSGDGSGSL
RRSGSFGKLRDALRRSSEMLVRKLQGGGPQEPPNSRMKRASSLNFLNKSVEEPVQPGGTG
LSDSRTLSSSSMDLSRRSSLVG
NT seq 1869 nt   +upstreamnt  +downstreamnt
atggccacgatggtgcttcctcgagaggagaagctgagtcaggacgagatagtactgggc
accaaggcggttatccagggtttagagacccttcgaggggagcatcgtgccctgctagct
cccctagcttctcatgaggcaggcgaggccgagccgggctcacaggagcgctgcctcctc
ctgcgccgctccctggaggccatcgagctggggcttggggaggctcaggtgatcttggca
ttgtcaagccatctgggggctgtggagtcagagaagcagaagctgcgggctcaggtgcgg
cgcctggtacaagagaaccagtggttgcgtgaggagctggcagggacacagcagaagctg
cagcgcagtgaacaggcggtggctcagctggaggaagaaaagcagcacctgctattcatg
agtcagatccgaaagctggatgaggatgcttccccaaatgaggagaagggtgatgttccc
aaggactccctggatgacctgtttcccaatgaagacgaacagagcccagcccccagccct
ggaggaggggatgtagctgcacagcatgggggctatgaaatcccggcacggctacgcacc
cttcacaatctggtgatccagtatgcttcacaaggccgctatgaggtggccgtgcccctc
tgcaagcaggcactggaggatttggagaaaacatcaggccatgaccaccccgatgtggcc
accatgctgaacatcctggcactggtttatcgggaccagaataagtacaaggatgctgct
cacctgctcaatgatgccctggctatccgggaaaagacactgggcaaggaccacccagct
gtggctgcaaccctcaacaatctggctgttttgtatggcaaacggggcaagtacaaagag
gctgaaccactgtgcaagagagcattggagatccgggaaaaggtcctgggcaagtttcat
ccagatgtggccaagcagctcagcaacctggccttgctgtgccagaaccagggcaaagct
gaggaggtggaatactactaccggagagccttggagatctatgccacacgccttggtcct
gatgaccccaatgtagcgaagaccaagaacaacctggcttcctgctacctgaaacagggc
aagtaccaggatgcagagaccctgtacaaggagatccttacccgtgctcatgagaaagag
tttggctcagtcaatggagagaacaagcccatctggatgcatgcagaggaacgagaggag
agcaaggataagcgccgggacagtgccccctatggggagtacggcagctggtacaaagcc
tgtaaagttgacagtcccacagtcaacaccactctgcgaagcttgggcgccctgtaccgg
cgccagggcaagctggaagctgcacacacactggaagactgtgccagccgcagccgcaaa
cagggcctggatcctgccagccagaccaaggtggtagaactgctaaaagatggtagtggt
ggacgaggagaccgccgtggcagcagagatgtggccgggggtgctgggcctcggtctgag
tctgacctggaggaatcagggcctgcagctgaatggagtggggatggcagtggctctttg
aggcgcagtggctcctttgggaagctccgggatgccctcagacgcagcagtgagatgctg
gtgaggaagctgcagggaggtggcccacaggagccccctaattctaggatgaagagggcc
agctctcttaacttccttaacaagagtgtggaagaaccagtccagcctggaggcacgggt
ctttctgacagccgcactttgagctccagctccatggacctctcccgaagaagctccctc
gtgggctaa

KEGG   Rattus norvegicus (rat): 311024
Entry
311024            CDS       T01003                                 

Gene name
Kif5c
Definition
(RefSeq) kinesin heavy chain isoform 5C
  KO
K10396  kinesin family member 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04728  Dopaminergic synapse
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
rno05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    311024 (Kif5c)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    311024 (Kif5c)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    311024 (Kif5c)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    311024 (Kif5c)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    311024 (Kif5c)
   05012 Parkinson disease
    311024 (Kif5c)
   05014 Amyotrophic lateral sclerosis
    311024 (Kif5c)
   05016 Huntington disease
    311024 (Kif5c)
   05020 Prion disease
    311024 (Kif5c)
   05022 Pathways of neurodegeneration - multiple diseases
    311024 (Kif5c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    311024 (Kif5c)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    311024 (Kif5c)
   04147 Exosome [BR:rno04147]
    311024 (Kif5c)
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Others
    311024 (Kif5c)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     311024 (Kif5c)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   311024 (Kif5c)
SSDB
Motif
Pfam: Kinesin Microtub_bd
Other DBs
NCBI-GeneID: 311024
NCBI-ProteinID: NP_001101200
RGD: 1308539
Ensembl: ENSRNOG00000004680
Structure
PDB: 
2KIN 3KIN

Position
3
AA seq 955 aa
MADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGEETVVIGQGKPYVFDRVLPPNTTQE
QVYNACAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEV
MDVIDEGKANRHVAVTNMNEHSSRSHSIFLINIKQENVETEKKLSGKLYLVDLAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLGGNCRTTI
VICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVNLELTAEEWKKKYEKEKEKNKALKSVI
QHLEVELNRWRNGEAVPEDEQISAKDQKNLEPCDNTPIIDNITPVVDGISAEKEKYDEEI
TSLYRQLDDKDDEINQQSQLAEKLKQQMLDQDELLASTRRDYEKIQEELTRLQIENEAAK
DEVKEVLQALEELAVNYDQKSQEVEDKTRANEQLTDELAQKTTTLTTTQRELSQLQELSN
HQKKRATEILNLLLKDLGEIGGIIGTNDVKTLADVNGVIEEEFTMARLYISKMKSEVKSL
VNRSKQLESAQTDSNRKMNASERELAACQLLISQHEAKIKSLTDYMQNMEQKRRQLEESQ
DSLSEELAKLRAQEKMHEVSFQDKEKEHLTRLQDAEEVKKALEQQMESHREAHQKQLSRL
RDEIEEKQRIIDEIRDLNQKLQLEQERLSSDYNKLKIEDQEREVKLEKLLLLNDKREQAR
EDLKGLEETVSRELQTLHNLRKLFVQDLTTRVKKSVELDSDDGGGSAAQKQKISFLENNL
EQLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENAMRDRKRYQQEV
DRIKEAVRAKNMARRAHSAQIAKPIRPGHYPASSPTAVHAVRGGGGSSNSTHYQK
NT seq 2868 nt   +upstreamnt  +downstreamnt
atggcggatccagccgaatgcagcatcaaagtgatgtgccggttccggcccctcaacgaa
gctgagatcctccgcggggacaaattcatccccaaattcaaaggcgaggagacggtggtg
atcgggcaagggaagccgtatgtctttgaccgagttctgccgcccaacacaacccaggag
caggtctacaatgcctgtgcgaagcagattgtcaaagatgtcctcgagggttacaatggg
acaatttttgcatacgggcagacttcatcaggaaaaactcataccatggaggggaagctg
cacgatcctcagcttatgggtatcatacccaggatcgcacacgatattttcgatcacatc
tattccatggatgagaacttggagtttcatatcaaggtttcctattttgagatctacttg
gacaaaataagggacttgcttgacgtgtccaagaccaacttggctgttcatgaagacaaa
aacagagtcccctatgtaaaggggtgcaccgagaggtttgtgtcaagcccggaggaggtc
atggatgtgatcgatgagggcaaagcaaaccgacatgtggctgtgacaaacatgaacgaa
cacagctccaggagtcacagtatcttcctgattaacattaaacaagagaatgtggagact
gaaaaaaaactcagcgggaagctgtatttggttgatttggctgggagtgaaaaggtcagc
aaaactggtgccgagggagctgttcttgatgaagctaaaaatatcaacaagtctttgtct
gctcttggaaatgtgatctctgccttggcagaagggacaaaaacacatgtgccataccgg
gacagcaagatgactcggattctccaggactctctgggtgggaactgcaggaccaccatt
gtcatttgctgttctccttcagtcttcaatgaggctgagaccaagtccacgctgatgttt
ggacagagagcaaagaccatcaagaatacagtctctgtgaacttggaactaacagcagaa
gaatggaagaagaaatatgaaaaagagaaagagaagaataaggccctgaagagtgtcatc
cagcatctggaggtggagctgaacaggtggaggaacggggaagctgtgcctgaggatgaa
cagatcagtgccaaggaccagaagaacctggagccctgcgacaacacacccatcatagac
aacatcacacctgtggttgacggcatctctgctgagaaagagaagtatgacgaggaaatc
accagtctgtaccgacagctggatgacaaggacgatgaaattaaccagcagagccagctg
gctgaaaagctgaagcaacagatgttggatcaggacgagcttctagcttccaccagaagg
gactacgagaaaatccaggaggagctgacccgcctccagattgaaaacgaggcggctaaa
gacgaggtgaaggaggtcctccaggccctggaggagctggctgtcaattacgaccagaag
tcacaggaagtggaggacaagacccgggccaacgagcaactgaccgatgagctggcccag
aaaacgacgacactgacaaccacccagcgggagctgagtcagctacaggagcttagcaac
caccagaagaagagggccacggagatcctgaacctgcttctcaaggatctgggcgagata
ggtggaattatcggcaccaacgatgtgaagaccctggcagatgtgaatggagtcatcgaa
gaggagttcaccatggcccgcctgtacattagcaagatgaagtcggaggtcaagtctctc
gtgaaccgcagcaagcagctggagagcgcccagacggactccaacaggaagatgaatgcc
agcgagcgggagctggcagcttgccagttgcttatctcgcagcatgaagccaagatcaag
tctctgacagactacatgcagaacatggaacagaagaggcggcagctggaagagtcgcag
gactccctcagcgaggagctggccaagctccgggcccaagaaaaaatgcacgaagtcagt
ttccaagataaggaaaaggagcacctgacgaggctgcaggatgctgaggaagtgaagaag
gctctggagcagcagatggagagtcaccgggaagcgcaccaaaagcagctgtccagactt
cgtgatgagattgaggagaagcagagaatcattgatgagattcgggatttgaatcagaag
ctgcaactggaacaggagaggctcagctctgattataacaagctgaaaatagaggaccag
gagagagaagtgaagctggagaagctcctattgctcaatgacaaaagagagcaagccagg
gaggacctcaagggactggaagagactgtgtccagagaactccagactcttcacaacctg
cgcaaactcttcgtccaggacttgaccacccgggtgaaaaagagtgtggagctggacagc
gacgatggagggggtagtgccgcccagaagcagaagatctccttcctggagaacaacctg
gagcagcttaccaaggtgcacaagcagctggtccgggacaatgcggatttgcgctgtgaa
ctccccaagctggagaagaggctccgtgctactgcagagcgtgtcaaggccttggagagt
gcgctcaaagaggccaaggagaatgccatgagggaccgaaagcgctaccagcaggaagtg
gatcgcatcaaggaggctgtgcgggccaagaacatggccaggagggcacattcggctcag
atcgccaagcccatccgcccaggacactatcctgcatcatctccaacagccgtccatgcc
gtccggggaggaggtggatcttcaaactccactcactaccagaagtaa

KEGG   Rattus norvegicus (rat): 314906
Entry
314906            CDS       T01003                                 

Gene name
Kif5a
Definition
(RefSeq) kinesin heavy chain isoform 5A
  KO
K10396  kinesin family member 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04728  Dopaminergic synapse
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
rno05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    314906 (Kif5a)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    314906 (Kif5a)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    314906 (Kif5a)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    314906 (Kif5a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    314906 (Kif5a)
   05012 Parkinson disease
    314906 (Kif5a)
   05014 Amyotrophic lateral sclerosis
    314906 (Kif5a)
   05016 Huntington disease
    314906 (Kif5a)
   05020 Prion disease
    314906 (Kif5a)
   05022 Pathways of neurodegeneration - multiple diseases
    314906 (Kif5a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    314906 (Kif5a)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    314906 (Kif5a)
   04147 Exosome [BR:rno04147]
    314906 (Kif5a)
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Others
    314906 (Kif5a)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     314906 (Kif5a)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   314906 (Kif5a)
SSDB
Motif
Pfam: Kinesin Microtub_bd
Other DBs
NCBI-GeneID: 314906
NCBI-ProteinID: NP_997688
RGD: 1303035
Ensembl: ENSRNOG00000005299
UniProt: Q6QLM7
Position
7
AA seq 1027 aa
MAETNNECSIKVLCRFRPLNQAEILRGDKFIPIFQGDDSVIIGGKPYVFDRVFPPNTTQE
QVYHACAMQIVKDVLAGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIARDIFNHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVTKTNLSVHEDKNRVPFVRGCTERFVSSPEEI
LDVIDEGKSNRHVAVTNMNEHSSRSHSIFLINIKQENIETEQKLSGKLYLADLAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKSYVPYRDSKMTRILQDSLGGNCRTTM
FICCSPSSYNDAETKSTLMFGQRAKTIKNTASVNLELTAEQWKKKYEKEKEKTKAQKETI
AKLEAELSRWRNGENVPETERLAGEDSALAAEICEETPVNDNSSIVVRIAPEERQKYEEE
IRRLYKQLDDKDDEINQQSQLIEKLKQQMLDQEELLVSTRGDNEKVQRELSHLQSENDAA
KEEVKEVLQALEELAVNYDQKSQEVEEKSQQNQLLVDELSQKVATMLSLESEPQRLQEVS
GHQRKRIAEVLNGLMKDLSEFSVIVGNGEIKLPVEISGAIEEEFTVARLYISKIKSEVKS
VVKRCRQLENLQVECHRKMEVTGRELSSCQLLISQHEAKIRSLTEYMQTVELKKRHLEES
YDSLSDELAKLQAQETVHEVALKDKEPDTQDAEEVKKALELQMENHREAHHRQLARLRDE
INEKQKTIDELKDLDQKLQLELEKLQADYERLKNEENEKSAKLQELTFLYERHEQSKQDL
KGLEETVARELQTLHNLRKLFVQDVTTRVKKSAEMEPEDSGGIHSQKQKISFLENNLEQL
TEVHKQLVRDNADLRCELPKLEKRLRATAERVKALEGALKEAKEGAMKDKRRYQQEVDRI
KEAVRYKSSGKRGHSAQIAKPVRPGHYPASSPTNPYGTRSPECISYTNNLFQNYQNLHLQ
AAPSSTSDVYFASNGATSVAPLASYQKANTDNGNATDINDNRSDLPCGYEAEDPAKLFPL
HQETAAS
NT seq 3084 nt   +upstreamnt  +downstreamnt
atggcggagaccaataacgaatgcagcatcaaggtgctttgccgatttcggcccctgaac
caggccgagatcctgcggggggacaagttcatccccattttccaaggggacgacagcgtc
attattgggggaaagccatatgtcttcgaccgtgtattccccccaaacacgactcaggag
caggtttaccacgcctgtgccatgcagatcgtcaaagacgtccttgctggctacaacggc
acaatttttgcttatggacagacatcctcagggaaaacgcacaccatggagggaaagctg
cacgaccctcagctcatgggcatcattccccggatcgcccgagacatcttcaaccacatc
tactccatggatgagaaccttgagttccacattaaggtgtcttactttgagatttacctg
gataagatccgtgaccttttggatgtgaccaagacaaacctgtctgtgcatgaggacaaa
aaccgggtgccgtttgtcaggggttgtaccgaacgctttgtgtccagcccagaggagatt
ctggatgtgattgatgaggggaagtcgaaccgtcacgttgccgtcaccaacatgaatgag
cacagctctcggagtcacagcatcttcctcatcaacatcaagcaggagaacatagagacg
gagcagaagctcagcgggaaactgtaccttgcggatctggccggaagcgagaaggtcagc
aagacaggagcagagggagccgttctggatgaggcaaagaatatcaataagtcgctgtcg
gccctggggaatgtgatctctgctctggccgagggcactaaaagctacgtgccgtaccgt
gacagcaaaatgacgaggattctccaggactctctgggagggaactgcaggaccaccatg
ttcatctgctgctcaccatccagctacaatgacgcagagaccaagtccacactcatgttt
gggcagcgggcaaagaccatcaagaacactgcctcagtgaatctggagttgactgctgag
caatggaagaagaaatatgagaaggagaaggagaagaccaaggcccagaaggagacaatt
gcgaagctggaggctgagcttagccggtggcgcaatggagagaatgtgcctgagactgag
cgcctggctggagaggactcagctctggcagccgagatctgtgaggagacccctgtgaat
gacaactcatccatcgtggtacgcatcgcaccggaggaaaggcagaaatacgaggaagag
atccgccgtctctacaagcagctcgacgacaaggatgatgagatcaaccagcagagccaa
ctcattgagaagctgaagcagcagatgctggaccaggaagagctgctagtgtccactcgg
ggagacaatgagaaggtccagcgggagctgagccacctgcagtctgagaacgatgccgcg
aaggaggaggtgaaggaagtgttgcaggccctggaggagctggcagtcaactatgaccag
aagtcccaggaggtggaggagaagagccagcagaaccagctgctggtggatgagctgtcc
cagaaagtggccaccatgctgtccctggagtctgagccacagcggctccaggaagtcagt
ggacaccagcgaaaacggatcgctgaggtgctgaatggactgatgaaggacctgagtgag
ttcagtgtcatcgtgggcaacggcgagattaagctgcctgtggagatcagtggggccatc
gaagaggagttcacggtggcccgactctacatcagcaagatcaagtcagaggtgaagtcc
gtggttaagcgatgccggcagctggagaacctccaagtggagtgtcatcgcaagatggag
gtgaccggtagggagctgtcgtcttgccagctgctcatctcacagcacgaggccaagatc
cgttcgctcacggaatacatgcagactgtggagttgaagaagcggcacctggaagagtcc
tatgactccctgagcgatgagctagccaagctccaggcgcaggaaactgtacacgaggta
gctctgaaagacaaggagccagatacgcaggatgcggaggaggtgaagaaggccctggaa
ctacagatggagaatcatcgtgaggcccatcaccggcagctggcccgcctccgagatgag
atcaatgagaaacagaagaccattgatgagcttaaagacctggaccagaagctccagtta
gagctggagaagcttcaggctgattacgagagactgaagaacgaagagaacgagaagagt
gccaagctccaggagctgacatttctgtatgagcggcatgagcagtccaagcaggacctc
aaggggctggaggagacagttgcccgtgaactccagaccctccacaacctgcgcaagctg
ttcgttcaagacgtcacgactcgagtcaagaaaagtgcagaaatggagcccgaggacagt
ggggggattcattcccaaaagcagaagatctcctttcttgagaacaacctggaacagctt
acagaggttcacaaacagctggtacgtgacaatgcagatctgcgttgtgagcttcctaaa
ttggaaaaacgacttcgggctacggctgagagagttaaggccctggagggtgcactgaag
gaggccaaggagggcgctatgaaggacaagcgccgataccagcaggaggtggaccgcatc
aaggaagctgtgcggtacaagagctctggcaagcggggccactctgcccagattgctaag
cctgtgaggcccggccactatcctgcctcctcacccaccaacccctacggtacccggagt
cccgagtgtatcagctacaccaacaacctcttccagaactaccagaacctgcacctgcag
gctgcgcctagctccacctcagacgtgtactttgccagcaacggagccacatctgttgcc
cccttggcttcctaccagaaggccaacacggacaatggaaacgccacagatatcaacgac
aacaggagtgacctgccctgcggctatgaggctgaggacccagccaagcttttccctctc
caccaagagacggcagccagctaa

KEGG   Rattus norvegicus (rat): 316226
Entry
316226            CDS       T01003                                 

Gene name
Klc4
Definition
(RefSeq) kinesin light chain 4
  KO
K10407  kinesin light chain
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    316226 (Klc4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    316226 (Klc4)
   05012 Parkinson disease
    316226 (Klc4)
   05014 Amyotrophic lateral sclerosis
    316226 (Klc4)
   05016 Huntington disease
    316226 (Klc4)
   05020 Prion disease
    316226 (Klc4)
   05022 Pathways of neurodegeneration - multiple diseases
    316226 (Klc4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    316226 (Klc4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    316226 (Klc4)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     316226 (Klc4)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     316226 (Klc4)
SSDB
Motif
Pfam: TPR_12 TPR_10 TPR_7 TPR_1 TPR_2 TPR_8 TPR_MalT TPR_16 TPR_19 ANAPC3 TPR_14 TPR_17 PPR JIP_LZII RPN7 DUF6241 TMF_TATA_bd TMF_DNA_bd LUD_dom Csm1_N COG2 TPR_11
Other DBs
NCBI-GeneID: 316226
NCBI-ProteinID: NP_001009601
RGD: 1306555
Ensembl: ENSRNOG00000018168
UniProt: Q5PQM2
Position
9
AA seq 619 aa
MSGLVLGQRDEPAGHRLSQEEILGSTRLVSQGLESLHSEHQAVLQSLSHTIECLQQGGHE
EGLVHEKARQLRRSMENIELGLSEAQVMLALASHLSTVESEKQKLRAQVRRLCQENQWLR
DELAGTQQRLQRSEQAVAQLEEEKKHLEFLRQLRQYDEDGHSMEEKEGDASKDSLDDLFP
NEEEEDSSNDLSRGQGAAAAQQGGYEIPARLRTLHNLVIQYAAQGRYEVAVPLCKQALED
LERTSGRGHPDVATMLNILALVYRDQNKYKEAAHLLNDALSIRESTLGRDHPAVAATLNN
LAVLYGKRGKYKEAEPLCQRALEIREKVLGTDHPDVAKQLNNLALLCQNQGKYEAVERYY
QRALAIYERQLGPDNPNVARTKNNLASCYLKQGKYSEAETLYKEILTRAHVQEFGSVDDD
HKPIWMHAEEREEMSRSRSRESGTPYAEYGGWYKACRVSSPTVNTTLRNLGALYRRQGKL
EAAETLEECALRSRKQGTDPISQTKVAELLGEGDGRKTMQEGPGDSVKFEGGEDASVAVE
WSGDGSGTLQRSGSLGKIRDVLRRSSELLVRKLQGTEPRPSSSNMKRAASLNYLNQPNAA
PLQTSRGLSASTVDLSSSS
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgtcaggcctggtattggggcagcgggatgagcctgcagggcaccggctcagtcaagag
gagatcttgggcagtaccaggttggtgagccaagggctggagtccctacacagtgagcac
caggctgtgctacagagcctgtcccacaccatcgagtgtctgcaacagggaggccatgag
gaaggactggtgcatgagaaagcccggcagctgcgacggtctatggagaacattgagctg
ggactcagcgaggcccaggtgatgctggctctggctagccacctgagcacagtggagtct
gagaagcagaagctgcgggcccaagtacggcggctctgccaggagaatcagtggctccgg
gacgagctggcgggcactcagcagcggctgcagcgcagcgagcaggctgtagcacagctg
gaggaagagaagaagcacctggagttcttaaggcagctgcgccagtatgacgaggatggg
cacagcatggaggagaaggagggagatgctagcaaagattccctggatgacctcttcccc
aatgaggaggaggaggactccagcaacgacttgtcccgtggtcagggtgctgcagcggcc
cagcagggtggatatgagatcccagcaaggttgcggaccctgcacaacctggtcatccag
tatgcagctcagggtcgctatgaggtggctgtgccactctgcaagcaagcgctagaggac
ctggagcgcacatctggccgaggtcaccctgacgtggctactatgctcaatatcctggct
ttggtgtatcgggaccagaataaatacaaggaggctgctcatctgctgaacgatgccctc
agcatccgggagagcaccctgggccgggaccacccagccgtggctgccacgctcaacaat
ctggccgtgctgtatggcaagcggggcaaatacaaggaagcagagccgctgtgccagcgg
gcactggagatccgagagaaggtcttgggcaccgaccatccggatgtggcaaagcagctg
aacaacttggccctcctatgtcaaaaccagggcaagtacgaggccgtggagcgctattat
cagcgggcactagctatctatgagcgccagctagggccggacaaccctaatgtagctcgg
accaagaataacctggcttcctgctacctaaagcagggcaagtactctgaggctgagact
ctgtataaagagatcctgacccgtgcccacgtgcaggagttcggatctgtggatgatgac
cacaagcccatatggatgcacgctgaggagcgggaggagatgagcaggagccggtcccgt
gagagcggcacgccctatgcagagtatggagggtggtacaaggcctgcagagtgagcagc
cccacggtgaacacgacgctaaggaacctaggggctctgtacaggcgccagggaaagctg
gaggcagctgagaccctggaggagtgtgccctgcgctccaggaaacagggtactgacccc
atcagtcagaccaaggtggccgagctgctgggggaaggtgatggtagaaagaccatgcag
gagggccctggagacagtgtgaagttcgagggaggtgaagatgcgtcagtggctgtggag
tggtcaggggatggcagtggcaccctccagaggagtggctctctgggcaagatccgggat
gtgcttcgtagaagcagtgagctcctggtgaggaagctccaaggcactgagcctcggcct
tccagcagcaacatgaagcgggcagcctcactgaactacctgaaccaacccaatgcagcc
cccctccagacttcccggggcctcagtgccagcaccgtggacctttcttcaagcagctga

DBGET integrated database retrieval system