KEGG   Rattus norvegicus (rat): 117596
Entry
117596            CDS       T01003                                 

Gene name
Atp6v1b2
Definition
(RefSeq) V-type proton ATPase subunit B, brain isoform
  KO
K02147  V-type H+-transporting ATPase subunit B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04145  Phagosome
rno04150  mTOR signaling pathway
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    117596 (Atp6v1b2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    117596 (Atp6v1b2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    117596 (Atp6v1b2)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    117596 (Atp6v1b2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    117596 (Atp6v1b2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    117596 (Atp6v1b2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    117596 (Atp6v1b2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    117596 (Atp6v1b2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   117596 (Atp6v1b2)
SSDB
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N DUF2481
Other DBs
NCBI-GeneID: 117596
NCBI-ProteinID: NP_476561
RGD: 620284
Ensembl: ENSRNOG00000011891
UniProt: P62815
Position
16
AA seq 511 aa
MALRAMRGIVNGAAPELPVPTGGPMAGAREQALAVSRNYLSQPRLTYKTVSGVNGPLVIL
DHVKFPRYAEIVHLTLPDGTKRSGQVLEVSGSKAVVQVFEGTSGIDAKKTSCEFTGDILR
TPVSEDMLGRVFNGSGKPIDRGPVVLAEDFLDIMGQPINPQCRIYPEEMIQTGISAIDGM
NSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVKKSKDVVDYSEENFAIVFAAMGVNMET
ARFFKSDFEENGSMDNVCLFLNLANDPTIERIITPRLALTTAEFLAYQCEKHVLVILTDM
SSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRNGSITQIPILTMPNDD
ITHPIPDLTGYITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHADVSN
QLYACYAIGKDVQAMKAVVGEEALTSDDLLYLEFLQKFEKNFITQGPYENRTVYETLDIG
WQLLRIFPKEMLKRIPQSTLSEFYPRDSAKH
NT seq 1536 nt   +upstreamnt  +downstreamnt
atggcgttgcgagcgatgcggggaatcgtgaacggggccgcgcccgagctgcccgtgccc
accggtgggccgatggccggagctcgggagcaggcgctggcggtgagccggaactacctc
tcccagcctcgtctcacctacaagactgtctctggagtgaatggtccactagtgatctta
gatcatgtaaagtttcccagatatgctgagattgtccacttgacattaccagatggcaca
aaaagaagtgggcaagttctagaagttagtggctccaaagccgtggttcaggtatttgaa
ggaacatccggcatagatgccaagaaaacatcctgtgagtttactggagatattctccgc
acaccagtgtctgaggatatgcttggtcgagtattcaatggatcaggaaaacccattgac
cgaggtcctgtggtgttggccgaagacttccttgacatcatgggtcagccaatcaaccct
cagtgtcgcatctacccagaagagatgattcagacgggcatttctgccatcgatggcatg
aacagtattgcgaggggacagaaaatccccatcttttctgctgccgggttaccacacaac
gagattgcagctcagatctgtcgccaggctggtttggtaaagaaatccaaagacgtggta
gactacagtgaagaaaactttgccattgtgtttgctgctatgggagtaaacatggaaaca
gcccggttcttcaaatctgactttgaagaaaatggctcaatggacaatgtctgccttttc
ttgaatctggctaatgacccaactatcgagaggatcatcactcctcgcctggctctgacc
accgctgagtttctggcttaccagtgtgagaagcatgtcctggtcatcctgacagatatg
agttcttacgctgaagcacttcgagaggtttcagctgccagggaagaggttcctggtcgg
cgaggcttccccggctacatgtatacggatttagccaccatctatgaacgcgctgggcga
gtggaaggtagaaatggctctattacccaaatccctattctcaccatgcccaatgatgat
atcactcatcctatccctgacttgactgggtatattactgagggccagatctatgtggac
agacagctgcacaacagacagatttaccctcctattaatgtgctgccctcactctctcgg
ttaatgaagtcagctattggagaaggaatgaccaggaaggatcatgctgatgtgtctaac
cagttgtacgcatgctatgctatcggtaaggatgtgcaagccatgaaagctgtggtggga
gaagaagccctgacctcagatgacctcctttacttggaatttctgcagaagtttgagaaa
aacttcattactcagggtccctatgaaaatcgaactgtctatgagactttggacattggc
tggcagttgcttcgaatcttccccaaagaaatgctgaagaggatccctcagagtaccctg
agcgaattttaccctcgagactctgcaaagcactag

DBGET integrated database retrieval system