KEGG   Rattus norvegicus (rat): 117955
Entry
117955            CDS       T01003                                 

Gene name
Slc4a7, NBC3, NBCn1
Definition
(RefSeq) solute carrier family 4 member 7
  KO
K13858  solute carrier family 4 (sodium bicarbonate cotransporter), member 7
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    117955 (Slc4a7)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    117955 (Slc4a7)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   USH complex and associated proteins
    117955 (Slc4a7)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   117955 (Slc4a7)
SSDB
Motif
Pfam: HCO3_cotransp Band_3_cyto CPT
Other DBs
NCBI-GeneID: 117955
NCBI-ProteinID: NP_001257790
RGD: 621208
Ensembl: ENSRNOG00000005957
UniProt: Q9R1N3
Position
15p16
AA seq 1218 aa
MEADGAGEQMRPLLTRGPDEEAVVDLGKTSSTVNTKFEKEELESHRAVYVGVHVPFSKES
RRRHRHRGHKHHHRRRKDKDSDKEDGRESPSYDTPSQRVQFILGTEDDDEEHIPHDLFTE
MDELCYRDGEEYEWKETARWLKFEEDVEDGGDRWSKPYVATLSLHSLFELRSCILNGTVM
LDMRASTLDEIADMVLDNMIASGQLDDSIRENVREALLKRHHHQNEKRFTSRIPLVRSFA
DIGKKHSDPHLLERNGEGLSASRHSLRTGLSASNLSLRGESPLSLLLSHLLPSSRAGTPA
GSRCTTPVPTPQNSPPSSPSLSRLTSRSSQQTQPQAPEVLVSPDRDDIPRVVIHPPEEDI
EALKGQEQKNEENTDFTPGILASPQSAPGNLDSSKSGEVKGNGSGGSRENSTVDFSKVDM
NFMRKIPTGAEASNVLVGEVDFLERPIIAFVRLAPAVLLSGLTEVPVPTRFLFLLLGPAG
KAPQYHEIGRSIATLMTDEIFHDVAYKAKDRNDLLSGIDEFLDQVTVLPPGEWDPSIRIE
PPKSVPSQEKRKIPAFPNGSAPVSADPPKEADHHAGPELQRTGRLFGGLILDIKRKAPFF
LSDFKDALSLQCLASILFLYCACMSPVITFGGLLGEATEGRISAIESLFGASLTGIAYSL
FAGQPLTILGSTGPVLVFEKILFKFCRDYHLSYLSLRTSIGLWTSFLCIVLVATDASSLV
CYITRFTEEAFAALICIIFIYEALEKLFHLGEIYAFNMHNNLDALTSYTCVCAEPSNPSN
ETVELWERKNVTAASISWANLTVSECKTFHGMFVGSACGPHGPYVPDVLFWCVVLFFTTF
FLSSFLKQFKTKRYFPTKVRSTISDFAVFLTIVIMVAIDYLVGIPSPKLHVPEKFEPTDP
SRGWIISPLGDNPWWTLLIAAVPALLCTILIFMDQQITAVIINRKEHKLKKGAGYHLDLL
MVAVMLGVCSIMGLPWFVAATVLSISHVNSLKVESECSAPGEQPKFLGIREQRVTGLMIF
ILMGLSVFMTSVLKFIPMPVLYGVFLYMGVSSLKGIQFFDRIKLFGMPAKHQPDLIYLRY
VPLWKVHVFTVVQLTCLVLLWVIKASAAAVVFPMMVLALVFVRKLMDLCFTKRELSWLDD
LMPESKKKKEDDKKKKEKEEAERMLQGDGDTVHLPFERGSLLQIPVKTLKYSPEKPVSVT
INFEDEPSKKYMDAETSL
NT seq 3657 nt   +upstreamnt  +downstreamnt
atggaggcagacggggccggcgagcagatgagaccgctactcacgcggggtcccgatgaa
gaagctgttgtggatcttggcaaaactagctcaaccgtgaacaccaagtttgaaaaagaa
gaattagagagtcatcgagctgtatatgttggtgttcatgtaccgtttagtaaagagagt
cgtcggcgtcacaggcatcgagggcacaaacatcaccaccggagaagaaaagacaaagac
tcagataaggaagatggacgggagtctccttcttatgacacgccatcgcagagggtgcag
ttcatccttgggactgaagacgatgatgaggagcacattccccacgacctcttcacggag
atggacgagctctgctaccgagacggggaagagtacgagtggaaagagacagccaggtgg
ctgaagttcgaagaggatgttgaggatggtggtgaccgatggagtaaaccgtatgtggcc
actctgtctttgcacagtctctttgagctgaggagttgtatcctaaatggaacagtcatg
ctggatatgagagcaagcactctggatgaaatagcagatatggtgttagacaacatgata
gcgtctggccagctagatgactccataagggagaatgttcgagaagctcttctgaagaga
catcatcatcaaaatgagaaaaggtttacaagtcggattcccctcgttcgatcctttgca
gatataggcaagaaacattctgaccctcacttgcttgaaaggaatggggaaggcctgtca
gcctcccgccattctttgcgaacaggtctgtctgcctcaaacctttccttgagaggagaa
tcgcctttatcccttcttctcagtcatcttcttccttcttcaagagctggcacccctgca
ggctcaaggtgtaccaccccagtacccaccccccagaacagtcctccttccagccccagc
ttaagtcgcctgacctccagaagttcccaacagactcagcctcaggccccagaagtactg
gtgtcacctgacagggatgatattcccagagtagtaattcatccgcctgaggaagacata
gaagcactgaaaggccaagagcagaagaatgaggaaaatactgacttcactccagggatt
ttggcttctccacagtctgctcctggaaacctggacagtagtaaaagtggtgaagtgaaa
ggtaacggaagtggaggaagcagagaaaatagtactgttgactttagcaaggttgacatg
aatttcatgaggaaaattcctacaggagctgaggcatccaatgttttggtaggagaggtg
gatttcttggagagacctatcattgcatttgtgagactggctcctgcagttctcctctca
gggttgactgaggtccctgtgcccactaggtttttgtttctgttactgggcccagcagga
aaggctccacagtaccatgaaattggcagatccatagcaactctaatgacagatgagatt
tttcatgatgtagcttataaagcaaaagatcgaaatgacctcttatctggaattgatgaa
tttttagatcaagtaactgttcttcctccaggagagtgggatccttccatacgcatagag
ccaccaaaaagtgttccttctcaggagaaaaggaagattcctgcgtttcccaatggatct
gctccagtgtctgctgaccctcctaaggaggctgatcaccacgctgggcctgagctgcag
aggactggacggctttttggtggtttgatacttgacatcaaaaggaaagcaccttttttc
ttgagtgacttcaaggatgcattaagtctgcagtgcctggcctcgattcttttcctatac
tgtgcctgtatgtctcctgtaatcacttttggagggctgcttggagaagctacagaaggc
agaataagtgcaatagagtctctttttggagcatcattaactgggattgcctattcattg
tttgctgggcaacctctaacaatactggggagcacgggtccagtcctagtgtttgaaaaa
attttatttaaattctgtagagattatcacctatcctatctatcattaagaaccagtatt
ggtctgtggacttctttcttgtgcattgtgttggtcgcaacagatgccagcagccttgtt
tgttacattactcggttcacagaagaagctttcgccgcactcatttgtatcatcttcatc
tatgaagccttggagaaactctttcacttaggagaaatatatgcatttaacatgcacaac
aacttggatgcattgaccagttacacatgtgtatgtgctgagccatctaatcctagcaac
gaaactgtagagctgtgggagaggaagaacgtgacagcagccagtatttcctgggcaaac
cttaccgtgtctgagtgtaagaccttccacggtatgtttgtgggatcagcttgtgggcct
cacgggccttatgttcccgatgtgctcttctggtgtgtcgtcttgtttttcacaacgttc
tttctgtcttcattcctcaagcagtttaagaccaagagatattttcctactaaggtgcga
tcaacaatcagtgactttgctgtatttctcacaatagtaataatggttgcaattgactac
cttgtaggaattccatctcctaaacttcatgttcctgaaaagtttgagcctactgatcca
agcaggggctggatcataagccctttgggagataacccttggtggaccttactaattgca
gctgttccagctctcctttgtaccattctcatcttcatggaccagcagatcacagctgtg
atcatcaacaggaaagaacacaaactgaagaaaggagctggctatcacctggacttgctc
atggttgctgtcatgttgggagtctgctccatcatgggcctgccgtggtttgtggctgca
acagtgttgtctataagtcatgtcaacagcttaaaagtagagtctgaatgttctgctcca
ggggaacagcccaagttcctcggaattcgtgaacagcgggttacagggctgatgattttt
atcctgatgggcctctctgtgttcatgacttcagtattaaagtttattccgatgccagtt
ctatatggtgttttcctttatatgggagtttcttctctgaaaggaattcagttttttgac
cgtatcaaattatttggaatgcctgccaagcaccagccggacctgatctacctccgctat
gtccctctctggaaggtgcacgtgttcacggtcgtccagctgacctgcctggttctgctc
tgggtgatcaaagcctctgctgctgcagtagtttttcccatgatggttcttgcattagtc
tttgtgcgcaagctcatggatctgtgcttcacaaagagagaactcagttggcttgatgac
ctcatgccagaaagtaagaaaaagaaagaagatgacaagaagaagaaggagaaggaggaa
gctgagcggatgcttcagggtgacggggatactgtgcacctcccattcgaaagggggagt
ctcctacaaattccagttaagaccctaaaatatagccctgaaaagcctgtgagtgtgaca
ataaatttcgaagatgaaccatcaaaaaaatacatggatgctgaaacttcattgtaa

DBGET integrated database retrieval system