KEGG   Rattus norvegicus (rat): 140433Help
Entry
140433            CDS       T01003                                 

Gene name
Lama5
Definition
(RefSeq) laminin subunit alpha 5
  KO
K06240  laminin, alpha 3/5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno05145  Toxoplasmosis
rno05146  Amoebiasis
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    140433 (Lama5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    140433 (Lama5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    140433 (Lama5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    140433 (Lama5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    140433 (Lama5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    140433 (Lama5)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    140433 (Lama5)
   05145 Toxoplasmosis
    140433 (Lama5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF Laminin_N Laminin_G_2 Laminin_I Laminin_G_1 Laminin_II Laminin_B Laminin_G_3
Motif
Other DBs
NCBI-GeneID: 140433
NCBI-ProteinID: NP_001178538
RGD: 621023
Ensembl: ENSRNOG00000053691
UniProt: F1MAN8
Position
3q43
AA seq 3713 aa AA seqDB search
MAKRGGQLCVGCAPGARGPRSLAPLPLLLLAGLALVGEARIPGGDGFSLHPPYFNLAEGA
RITASATCGEEAPTRSASRPTEDLYCKLVGGPVAGGDPNQTIQGQYCDICIAANSNKAHP
VSNAIDGTERWWQSPPLSRGPEYNEVNVTLDLGQVFHVAYVLIKFANSPRPDLWVLERST
DFGHTYQPWQFFASSKRDCLERFGPRTLERITQDDDVICTTEYSRIVPLENGEIVVSLVN
GRPGARNFSYSPVLRDFTKATNIRLRFLRTNTLLGHLMGKALRDPTVTRRYYYSIKDISI
GGRCVCHGHADVCDAKDPSDPFRLQCACQHNTCGGSCDRCCPGFNQQPWKPATTDSANEC
QSCNCHGHAYDCYYDPEVDRRNASQNLDNVYQGGGVCLDCQHHTTGINCERCVPGFYRAP
DQPLDSPHVCQPCDCESDFTDGTCEDLTGRCYCRPNFTGERCSACAEGYVDFPHCYPLPS
FPHNDTGEQVLPAGQIVNCDCNAAGTQGNACRKDPRLGRCVCKPNFQGNHCELCAPGFYG
PSCHPCQCSSPGVANGLCDPESGQCTCRTGFEGDKCDHCALGYFHFPLCQLCGCSPAGTL
PQGCDESGHCQCRPGFDGPHCDRCLPGYHGYPDCHACACDPRGSLDQQCGAGGLCHCRPG
YTGATCQECSPGFYGFPSCIPCHCSADGSMHTTCDPTTGQCRCRPRVTGLRCDMCVPGAY
NFPYCEAGSCHPAGLAPANPALPEAQAPCTCRAHVEGPSCDRCKPGYWGLSSSNPEGCTR
CSCDPRGTLGGVTECQGNGQCFCKAHVCGKTCAACKDGFFGLDHADYYGCRSCRCDVGGA
LGQGCEPKTGACRCRPNTQGPSCSEPAKDHYLPDLHHIRLELEEAATPEGHAVRFGFNPL
EFENFSWRGYAHMTAIQPRIVARLNVTSPDLFRLVFRYVNRGSTSVNGQVSVREEGKFSS
CTNCTEQSQPVAFPPSTEPAFVTVPQRGFGEPFVLNPGTWALLVEAEGVLLDYVVLLPST
YYEAALLQHRVTEACTYHPSALHPTENCLLYAHLPLDGFPSAAGTEALCRHDNSLPRPCP
TEQLSPLHPPLATCAGSDVDIQLEMAVPRPGRYALVVEYVSEYSHQEMGVAVHTPQRAPQ
QGMIDLHPCPYSSLCRGPARDTQHHLAVFHLDSEASIRLTAEQAHFFLHSVTLIPVEEFS
AEFVEPRVFCVSSHGAFNPGSAACLASRFPKPPQPIVLKDCQVLPLPPDLPLTQSQELSP
GASPVGPQPRPPTAVDPNAEPTLIRHPQGTVVFTTQVPTLGRYAFLLHSYQPVHPSFPVE
VLIDGGRIWQGHANASFCPHGYGCRTLVSCEGQTMLDVTDNELAVTVRVPEGRWLWLDYI
LVVPEDAYSSSYLQEEPLDKSYDFISHCATQGYHISPSSSSLFCRNAATSLSLFYNNGAL
PCGCHEVGAVGPTCEPFGGQCPCRGHVIGRDCSRCATGYWGFPNCRPCDCGARLCDELTG
QCICPPRTVPPDCLVCQPQSFGCHPLVGCEECNCSGPGVQELTDPTCDMDSGQCRCRPNV
AGRRCDTCAPGFYSYPSCRPCDCHEAGTMASVCDPFTGQCHCKENVQGSRCDQCRVGTFS
LDAANPKGCTRCFCFGATERCGNSNYARHEFMDMEGWVLLSSDRQVVPHEHRPEMELLHA
DLRLVADTFPELYWQAPPSYLGDRVSSYGGTLHYELHSETRRGDVFIPYESRPDVVLQGN
QMSIAFLELAYPSPGQVHRGQLQLVEGNFRHLETHNPVSREELMMVLAGLEQLQIRALFS
QTSSTVSLRRVVLEVASEAGGGPPASNVELCMCPANYRGDSCQECAPGYYRDTKGLFLGR
CVPCQCHGHSDRCLPGSGTCVGCQHNTEGDQCERCRPGFVSSDPSDPASPCVSCPCPLAV
PSNNFADGCILRNGRTQCLCRPGYAGASCERCAPGFFGNPLVLGSSCQPCDCSGNGDPNM
IFSDCDPLTGACRGCLRHTTGPRCESCAPGFYGNALLPGNCTRCDCSPCGTETCDPQTGR
CLCKAGVTGQRCDHCLEGHFGFEQCQGCHPCACGPAAEGSECNPQTGQCHCRPGTTGPQC
LECAPGYWGLPEKGCRRCQCPRGHCDPHTGRCTCPPGLSGERCDTCSQQHQVPVPGRPGS
HGIHCEVCDHCVVLLLDDLERAGALLPSIREQLRGINASSTAWARLHRLNASIADLQSKL
RSPLGPHNQTAEQLQTLEQQSISLQQDTERLGSQATGVQDQAGRLLDNTESTLVRAQKLL
EIVQAVSRALNELASQGFPGNATTPSGEQLRWALAEVERLLWDMRTRDLGAPQAVAEAEL
AEAQRLMARVQEQLTSFWEENQALATHIRDQLAQYESGLMDLREALNHAVNTTREADELN
SRNEERLREALQWKQELSQDNATLKATLQAASLTLAHVSELLQGIDKAKEDLEHLAASLD
GAWTPLLKRMQAFSPASSKVDLVEAAEAHAQKLNQLAINLSGIIQGINQDRFIQRAVEAS
NAYSSILQAVQAAEDAAGHALRQASRTWEMVVQRGLAAGARQLLANSSALVETILGHQER
LGLAHGRLQAAGTQLRDVRAKKNQLAAQIQEAQAMLAMDTSETSEKIAHAKAVAAEARDT
AAHVQSQLQGMQKNVERWQSQLGGLRGQDLSQAERDASSSVSTLEKTLPQLLAKLSHLEN
RGVHNASLALSANIGRVRKLIAQARSAANKVKVSMKFNGRSGVRLRTPRDLADLAAYTAL
KFYIQSPVPAPEPGENTGDRFVLYMGSRQATGDYMGVSLRNQKVHWVYRLGEAGPTTLSI
DENIGEQFAAVSIDRTLQFGHMSVTVEKHMVHEIKGDTVAPGREGLLNLNPDDFVFYVGG
YPSNFTPPEPLRFPGYLGCIEMDTLNEEVVSLYNFEQAFKLTTAVDKPCARSKTTGDPWL
TDGSYLDGSGFARITFEKQFSNTKRFEQELRLVSYNGIIFFLKQENQFLCLAVQDGTLVL
LYDFGSGLKRADPLQPPQALTAASKAIQVFLLAGARKRVLVRVERATVFSVDQDNELEMA
DAYYLGGVPPEELPPSLRRLFPSGGSVRGCIKGIKALGKYVDLKRLNTTGISFSCTADLL
MGRTMTFHGHGFLPLALPDVAPITGEVYSGFGFRGTQDDNLLYYRTSPDGPYQVSLRGGH
VTLQFMNREVETQRVFADGAPHYVAFYSNVTRVWLYVDDQLQPVKSREGTTPMLQLQPEE
PPRLLLGGLPMSGTFHNFSGCISNVFVQRLRGPQRVFDLHQNMGSVNVSVGCTPAQLQTS
GATAQKVSRRSRQPSQDLTCMTPWLLGTIQDAYQFGGPGPSYLQFVGVSPSHRNRLHLSM
LVRPHGASQGLLLYVAPLSSHSPSLVLFLNHGRFVAQTEGPGPQLQAQSRQHSRAGQWHR
VSVRWGMQQVQLVVDGSQTWSQKAPHRRVHRAEGPQHYTLFVGGLPAGSYSSKLPVSVGF
SGCMKKLQLDKRPLRAPTRMVGVTPCVSGPLEDGLFFPGSEGAVTLELPKAKMPHVSLEL
EVRPLAAAGLIFHLGQAHATPYVQLQLLTEQVLLRANDGAGEFSTWVTYPKLCDGQWHQV
TVIKGRNTLRLEVDTHSNHTTGRLPETLADSPALLHLGSPPKSEAAWPEPPAYRGCLRKL
LFNGAPVNMTASARIQGAVGMSGCPSGTLAISKQGKALTQRQANPSVFPLRWH
NT seq 11142 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcgcggagggcagctctgcgtggggtgcgcaccgggagctcgtggcccccgg
agcctcgcgccgctgcccttgctgctgctggctgggctggcgctggtaggcgaggcgcgc
attcccgggggcgatggcttcagcctgcacccgccctacttcaacctggcggagggcgct
cgcatcaccgcgtccgcgacctgcggcgaggaggccccgacgcgcagtgcctcacgcccc
accgaggacctctactgcaagctggttgggggtccggtggcgggcggagatcccaaccag
acaatccagggccagtactgtgacatctgtatagctgccaacagcaacaaggcacaccct
gtgagcaacgccatcgatggcacggagcgctggtggcagagcccacccctgtcccgtggc
ccggagtacaatgaggtcaacgtcacactggacctgggccaggtgttccacgtggcctat
gtgctcatcaagtttgctaactcacctcggcctgacctctgggtactggaacggtccaca
gacttcggccacacttaccagccatggcagttctttgcctcctccaagagggattgtttg
gagcggtttggacctcggactctagagcgcatcacgcaggacgacgatgtcatctgcacc
acagagtactcccgaatagtgcctctggagaacggcgagatcgtggtgtccctggtgaac
ggacgccctggggccaggaacttctcctattcaccagtacttcgagacttcaccaaggcc
accaacatccgcttgcggtttcttcgaaccaacacgctcttgggccaccttatgggcaag
gcgctgcgggaccccaccgtcacccgcaggtattattacagcatcaaagacatcagcatc
ggcggccgctgcgtctgtcatggccacgcagatgtctgtgacgctaaggacccctcggat
cctttcaggctgcagtgtgcctgccagcacaacacgtgtggaggctcttgtgaccgatgc
tgtccaggcttcaaccagcagccgtggaagcccgccaccacggacagcgccaatgagtgc
cagtcctgcaactgccatggccatgcctacgactgttactatgaccccgaggtggaccgg
cgcaacgccagccagaacctggacaacgtgtaccagggtggaggtgtctgcctggattgc
cagcaccacaccacgggtatcaactgcgagcgctgtgttcctggcttctaccgcgcccct
gaccagccactggactcgcctcatgtctgtcagccctgtgactgtgagtcagacttcacc
gatgggacctgcgaagacctgacgggccgctgttactgcaggccgaacttcacaggagag
cggtgttccgcctgcgctgagggctacgtggacttcccgcactgctaccctctgccttca
tttccccataatgacacgggagaacaggtgcttcctgccggacagatcgtgaactgtgac
tgcaacgccgctgggacccagggcaatgcctgccggaaggacccgaggttgggacgctgt
gtctgcaaacccaacttccagggcaaccactgcgagctctgtgctcccggattctacgga
cctagctgccacccatgccagtgttccagtcctggggtagccaatggcctctgtgaccca
gagtcaggccagtgcacgtgccgcaccggcttcgagggggacaagtgtgaccactgtgcc
cttggctatttccacttccctctctgtcagctatgtggctgcagtccagcagggaccttg
cctcaaggctgtgacgagtctggccattgccaatgccgacctggctttgatggtcctcac
tgtgaccgctgccttccaggataccatgggtaccccgactgtcatgcttgtgcctgtgac
cctcgggggtccctggatcaacagtgtggagcgggtggtttgtgccactgccgtcctggc
tacacgggcgccacttgtcaggaatgtagccccggattctacggctttcccagctgcatc
ccttgccactgctctgccgatggctccatgcatacaacctgtgaccctacaactggccag
tgtaggtgccgtccccgagtgacaggacttcgttgtgatatgtgtgtgccgggggcctat
aacttcccctactgcgaagctggctcttgtcatcctgctggtctggccccagccaatcct
gcccttcctgaggcacaggctccctgtacgtgccgggctcatgtggaggggccaagctgt
gaccgctgtaaacctgggtattggggactgagctccagcaaccctgaaggctgcacacgc
tgcagctgtgacccacgaggcacactgggtggagttactgagtgccagggcaatgggcag
tgtttctgcaaggctcatgtgtgtggcaagacctgtgcagcctgcaaggatggcttcttt
ggcctggatcatgctgactactatggctgccgtagctgcaggtgtgatgttggaggtgcc
ctgggtcagggctgtgaaccaaagacgggtgcctgcaggtgccgccctaacacccagggc
ccttcctgcagcgagccagcgaaggaccactacttgccagacctgcatcacatacggctg
gaactagaggaggcggccactcccgagggccatgccgtccgctttggcttcaaccccctg
gagtttgagaacttcagctggagaggctacgcacatatgacggctatccagcccaggatc
gtggccaggctgaacgtgacctcccctgacctctttcggctggtcttccgatatgttaac
cgtggatcgaccagcgtgaatgggcaggtctctgttcgggaagagggcaagttttccagc
tgtaccaactgcacagagcagagccagccagtggccttcccacccagcacagagcctgcc
tttgtcaccgtgccccagaggggctttggggagccctttgtgctgaaccccggcacctgg
gccttgctggttgaggctgaaggtgtactcttggactacgtggtcctcctgcccagcacc
tactacgaggcagctctcctacagcatcgagtaaccgaggcctgtacctaccatccctca
gccctgcaccccacagagaactgtctcctctatgctcacctacccctggatggcttccct
tccgctgctggaactgaggccctgtgtcgccatgacaacagcctgccccggccctgcccc
acagagcagctcagccccttacacccgcccttggcgacctgtgccggcagtgatgtggac
atccagcttgagatggcggtgcctcggccaggccgatatgctctcgtggtggagtacgtc
agtgagtattcacaccaggagatgggcgtggctgtgcacacccctcagagagccccgcag
caggggatgatcgacctccacccctgtccctacagctccctgtgccggggtccggctcgg
gatacccagcatcatttagctgtcttccacctggactctgaggccagcatccggctcacg
gctgagcaggctcacttcttcctgcacagtgtcaccctgatacctgtggaggagttcagc
gctgagtttgtggagccccgggtcttctgtgtgagcagtcatggagcgttcaaccccggc
agcgctgcctgtctagcctcccgattcccgaagccaccgcagcccatcgtccttaaggac
tgccaggtcttgccactgcctccagacctgcctctgacccagtctcaggagctctcaccg
ggagcatctccagtgggaccacagcctcggccgccaaccgcggtggatcctaatgcagaa
cccaccttgatacgccacccacagggcacggtggtcttcaccacccaggtgcccaccctg
ggccgttacgccttcctgctgcatagctaccagccggtccacccctccttccctgtggag
gtactcatcgacggtggccgcatctggcagggccacgccaatgccagcttctgtccacat
ggttatggctgccgtaccctggtgtcgtgcgagggtcaaacaatgttggatgttacggac
aacgagctcgccgtgaccgtgcgtgtgccagaaggccggtggctctggctggactacata
cttgtcgtccctgaggatgcctacagctccagttacctccaagaggagcccctggacaaa
tcctatgacttcatcagccactgcgccacccagggctaccacattagccccagcagctcg
tctctgttctgccggaacgctgccacctccttgtctctcttctacaacaatggggccctc
ccttgtggctgccacgaggtgggtgccgtaggccccacatgcgaacccttcgggggccaa
tgcccctgccggggccacgtcattggccgtgactgctcccgctgcgccactggctactgg
ggcttccccaactgcaggccctgtgactgcggagcccgcctgtgtgacgagctcacaggt
cagtgtatctgtcctccacgcactgtgccccccgactgcctggtctgccagccacagagc
tttggttgccaccccttggtgggctgtgaggagtgtaactgctcaggacccggcgtccag
gagctgacggaccccacctgtgacatggacagcggccagtgcagatgcagacccaatgta
gctgggcgtcgctgtgacacctgtgcaccaggcttctatagttatcctagctgtcgcccc
tgtgactgtcatgaggcaggcaccatggccagtgtgtgtgaccccttcacaggccagtgc
cattgcaaggagaatgtacagggctccagatgtgaccagtgtcgcgtggggaccttctcc
ttggatgctgctaaccccaagggctgtacccgctgcttctgtttcggagccacagagcgc
tgtggaaactctaactatgcccgccatgagttcatggacatggagggctgggtgcttttg
agcagcgaccgacaggttgtaccccacgagcatcggcccgagatggagctgctgcacgca
gatctgcggcttgtggccgacactttcccagagctgtactggcaggccccgccctcctac
ctgggagacagggtgtcatcctacggtgggaccctccactatgagctgcactcagagacc
cgtcgaggtgatgtcttcattccctacgagagccggccagatgtcgtgctgcagggcaac
caaatgagcatcgccttcctggagctggcgtacccttcacctgggcaggttcaccgaggg
cagctacagctggtagaggggaacttccggcacttggagactcacaacccagtgtcccga
gaggaactcatgatggtgctggccggcctggagcagctgcagatccgtgccctcttctca
cagacctcttccactgtctccttgcgtagagtggtactagaggtggccagcgaagctggc
ggggggcctccagccagcaatgtggaactgtgtatgtgccctgccaactaccgaggggac
tcatgccaggagtgcgcccctggctattaccgggacaccaagggtctcttcctgggccga
tgtgtcccctgccagtgccatgggcattcagaccgctgccttcctggctctggcacttgt
gtgggctgccagcacaacacagaaggggaccagtgtgagcgctgcagacctggcttcgtc
agcagtgatcccagtgaccctgcatctccctgtgtgagctgcccttgccccttggcggtg
ccctccaataattttgcagacggctgcatcttaagaaatggccgaacccagtgcctctgc
aggcctggctatgccggtgcctcctgtgaacggtgtgcacctggcttttttgggaaccct
ctggtgctaggcagctcctgtcagccctgcgactgcagcggtaatggagaccccaacatg
atcttcagtgactgcgaccccctgacaggcgcttgtcgaggctgcctccgtcatactacc
gggccccgctgtgaaagctgtgcccctggcttctacggcaatgccttgttgccaggcaac
tgcacccggtgtgactgttccccatgcgggacagaaacctgtgatccccagactgggcgc
tgcctgtgtaaggcaggcgtgactggacaacgttgtgaccactgtttggaaggacacttc
ggttttgagcaatgccagggctgccacccttgtgcctgtggaccagctgctgagggctct
gagtgcaaccctcagactggtcagtgtcactgccggccagggaccacaggaccccagtgc
cttgagtgtgctcctggctactggggactcccggagaaaggttgcaggcgctgccaatgt
ccacgaggccactgtgacccacacacaggccgctgcacctgtcctccagggctcagtggg
gagcgctgtgacacctgcagccagcagcaccaggtgcctgtaccgggcaggcctgggagc
catggcatacactgtgaggtgtgtgaccactgtgtggtcctgcttctggatgacctcgag
cgggctggtgccctccttccctccatccgtgagcagctgcggggtatcaatgccagctcc
acggcctgggccaggctgcacaggctgaatgcctccattgctgacctgcagagtaagctc
cggagcccactgggaccccacaaccagacagcagagcagctacagactctagagcagcaa
agtataagccttcaacaggatacagagaggctgggcagtcaggccacaggggtccaagat
caggcaggccggctgctggacaacacggagtccacgctggtccgggcacagaaattgttg
gagatcgtgcaagctgtgagccgtgccctgaatgaactggcatctcaaggatttccaggc
aatgccacaacaccgtctggcgagcagctgcgctgggcactggctgaagtggagcggcta
ctctgggatatgcggactcgtgacctgggggccccacaggcagtggcagaagctgaactg
gcagaagcccagaggctgatggcgcgtgtccaggagcagctgactagcttctgggaggag
aaccaggcattggccacacacattcgggaccagctggctcagtacgagtctggcctcatg
gacctccgtgaggccctgaaccatgcagtcaatactacccgggaggctgatgaactcaac
agccgcaatgaggagcggctgagagaagccctgcaatggaaacaggagctgtcccaggac
aacgccaccctaaaggccactctccaagctgccagtctcaccttggcccatgtttctgag
cttctgcagggcatagacaaggctaaggaggacctagagcacctggcggccagcctggat
ggagcctggacaccgctactgaagaggatgcaggccttttcccccgccagcagcaaggtg
gacttagtagaggctgctgaggcccacgctcagaagctgaatcagctggcgatcaacctg
tctggcattatccagggaatcaatcaggaccgcttcatccagagggcggtggaagcctcc
aatgcctatagcagcatcctgcaggccgtacaggctgccgaagatgccgcaggccacgcg
ctgaggcaggccagccgcacgtgggagatggtggtgcaacggggcctagcagctggagcc
cggcagctgttagccaacagcagtgccttggtggagaccatcttggggcaccaggagagg
ctgggccttgctcatggccgcctgcaggccgcggggacccagcttcgcgatgtccgtgcc
aagaagaaccagctggccgcccagatccaggaggcacaagccatgctggccatggacaca
agcgagaccagcgagaagatcgctcacgccaaggctgtggctgcagaagcccgcgacacg
gccgcccatgtgcagtctcagcttcagggtatgcagaagaatgtggagcggtggcagagc
cagctggggggcctgcgaggccaggacctgagccaggcggaacgggatgcaagcagttca
gtgtctaccctggagaagacattgccacagctgctggccaaactgagccatctggagaac
cgaggggtgcacaacgccagcctggccttgtctgccaacatcggtcgtgtgcgcaagctc
attgcccaggcccggagtgccgccaacaaggtcaaggtgtccatgaagttcaacgggcgt
tcgggggtacggctgcgcaccccacgagacctcgctgaccttgctgcctacaccgccctc
aagttctacatccagagcccagtgccagcgcctgaacctggcgagaacactggggaccgc
tttgttctgtacatggggagccgccaggccaccggggactacatgggagtgtctctgcgt
aatcagaaggtgcactgggtgtacaggttaggtgaggctggccccacaactctcagcatt
gacgagaacattggggagcagtttgcagccgtcagcattgacaggaccctccagtttggc
cacatgtctgtcacggtggagaagcatatggttcatgagatcaagggggacacagtggcc
cctgggagggagggactactcaacctgaatcctgacgattttgtcttctacgtgggagga
taccccagcaacttcacgccccctgaacccctccgattccctggctacctgggttgcatc
gagatggacacactgaatgaagaggtggtcagcctctacaactttgagcaggccttcaag
ctgaccactgcggtggataagccttgtgctcgctccaagaccaccggtgacccatggctc
acagatggctcctacctggacggcagtggctttgcccgcatcacctttgagaagcagttc
agcaacacaaaacgctttgaacaggagctgcgtcttgtgtcctacaatgggatcatcttt
ttcctcaagcaagagaaccagttcttgtgcctggcagtacaggacggcactcttgtactc
ctctatgacttcggctccggcctgaagagggcggacccactgcagcccccacaagccttg
acggcagccagcaaggcgatccaagtgtttctattggctggcgcccgcaaacgtgtgctg
gtgcgtgtggagcgggccactgtgttcagcgtagatcaggataacgagctggagatggct
gatgcctactacctgggaggtgtgccacctgaggagctgcccccaagcctacggcggctc
ttcccctcgggaggctctgtccgtggctgcatcaaaggtatcaaggctctgggcaagtac
gtggacctcaaacgactgaacaccacgggcatcagcttcagctgcaccgctgacctgcta
atgggacgcaccatgactttccacggccacggcttcctgcccctggcacttcccgatgtg
gcgccgatcactggagaggtctattctggcttcggctttcgtggcactcaggatgacaac
ctgctgtattaccgcacctccccggatgggccataccaggtatccctgagggggggtcac
gtgacactccagtttatgaacagagaggtggaaactcaacgggtctttgctgatggcgcc
cctcactatgttgccttctacagcaatgtcaccagggtatggctgtatgtggatgaccag
ctacaaccggtgaagtcccgtgagggaacaacccccatgctccaactacagcctgaggag
cccccacggcttctcctgggaggcctgcctatgtctggtaccttccacaacttcagtggt
tgcatcagcaacgtgtttgtgcagcgacttcggggaccacagcgtgtgtttgacctacac
cagaacatggggagtgtcaacgtaagcgtaggctgcacaccagcccaactccagacctca
ggggccacagctcagaaggtttcccgccgcagtcgccaacccagccaggacctcacctgc
atgacaccctggctccttgggactattcaggatgcgtaccagtttgggggacccgggccc
agttacctgcagtttgtgggtgtctccccatcccacaggaataggctccacctctcgatg
ctcgtccgcccacatggggcttcccagggcctcttgctctatgtagcccccttgtcgagc
cacagtccttcactggtactctttctaaaccatggacgctttgtcgcacagactgagggc
cctgggccccagctccaggcccagagtcgccagcactcacgggctggccagtggcacagg
gtgtctgtccgctggggaatgcagcaggtccagcttgtggtggatggcagccagacctgg
agccagaaggcgccccaccgccgggtccacagggcagagggtccacagcactacaccctc
tttgtaggaggtctccctgccggcagttacagttccaagcttcctgtgtctgtggggttc
agcggctgtatgaagaagttacaactggataagcggccactgagggccccaacaaggatg
gtgggggtcacaccctgtgtctcaggccccctggaagatggcctgttcttcccaggcagt
gagggagccgtcacattagagctccccaaggccaagatgccccatgtgagcctggagctg
gaggtgcggcccttggccgctgctggcctcatctttcacctgggccaggcccatgctact
ccctacgtgcagctgcagttgctaacagaacaggtcctgctacgggcaaatgatggggca
ggggagttctccacgtgggtgacctaccccaagctttgtgatggacagtggcaccaagtg
acagtgatcaagggcaggaacacactgcggctagaagtcgacacacacagcaaccacacc
acaggccgtttgccagagaccttggctgattctccagcgcttttgcaccttgggagcccg
cccaagtctgaagctgcctggccagagccccctgcctaccgaggatgtctgaggaagctg
ctgttcaacggggcccctgtcaacatgactgcttctgcacgcatccagggagcagtgggg
atgagcggatgcccctcaggaaccctagcaatttccaagcagggaaaggcactgacccag
aggcaggccaaccccagtgtcttcccgctacgctggcattga

DBGET integrated database retrieval system