KEGG   Rattus norvegicus (rat): 140447Help
Entry
140447            CDS       T01003                                 

Gene name
Slc8a2, Ncx2
Definition
(RefSeq) solute carrier family 8 member A2
  KO
K05849  solute carrier family 8 (sodium/calcium exchanger)
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04371  Apelin signaling pathway
rno04740  Olfactory transduction
rno04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    140447 (Slc8a2)
   04020 Calcium signaling pathway
    140447 (Slc8a2)
   04022 cGMP-PKG signaling pathway
    140447 (Slc8a2)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    140447 (Slc8a2)
  09157 Sensory system
   04740 Olfactory transduction
    140447 (Slc8a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    140447 (Slc8a2)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    140447 (Slc8a2)
Transporters [BR:rno02000]
 Solute Carrier Family (SLC)
  SLC8: Na+/Ca2+ exchanger
   140447 (Slc8a2)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate/Haparin
  Others
   140447 (Slc8a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Calx-beta Na_Ca_ex Na_Ca_ex_C
Motif
Other DBs
NCBI-GeneID: 140447
NCBI-ProteinID: NP_511174
RGD: 620194
Ensembl: ENSRNOG00000001492
UniProt: P48768
Position
1q21
AA seq 921 aa AA seqDB search
MAPLALVGVALLLGAPHCLGEATPTPSLPPPPANDSDASPGGCQGSYRCQPGVLLPVWEP
DDPSLGDKAARAVVYFVAMVYMFLGLSIIADRFMASIEVITSKEKEITITKANGETSVGT
VRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFQAGELGPGTIVGSAAFNMFVVIAVC
VYVIPAGESRKIKHLRVFFVTASWSIFAYVWLYLILAVFSPGVVQVWEALLTLVFFPVCV
VFAWMADKRLLFYKYVYKRYRTDPRSGIIIGAEGDPPKSIELDGTFVGTEVPGELGALGT
GPAEARELDASRREVIQILKDLKQKHPDKDLEQLVGIAKYYALLHQQKSRAFYRIQATRL
MTGAGNVLRRHAADAARRPGANDGAPDDEDDGASRIFFEPSLYHCLENCGSVLLSVACQG
GEGNSTFYVDYRTEDGSAKAGSDYEYSEGTLVFKPGETQKELRIGIIDDDIFEEDEHFFV
RLLNLRVGDAQGMFEPDGGGRPKGRLVAPLLATVTILDDDHAGIFSFQDRLLHVSECMGT
VDVRVVRSSGARGTVRLPYRTVDGTARGGGVHYEDACGELEFGDDETMKTLQVKIVDDEE
YEKKDNFFIELGQPQWLKRGISALLLNQGDGDRKLTAEEEEAQRIAEMGKPVLGENCRLE
VIIEESYDFKNTVDKLIKKTNLALVIGTHSWREQFLEAVTVSAGDEEEDEDGSREERLPS
CFDYVMHFLTVFWKVLFACLPPTEYCHGWACFGVCILVIGLLTALIGDLASHFGCTVGLK
DSVNAVVFVALGTSIPDTFASKVAALQDQCADASIGNVTGSNAVNVFLGLGVAWSVAAVY
WAVQGRPFEVRTGTLAFSVTLFTVFAFVGIAVLLYRRRPHIGGELGGPRGPKLATTALFL
GLWFLYILFASLEAYCHIRGF
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atggctcccttggctttggtaggggttgccctccttctgggggcaccccactgcttgggg
gaagctactccgaccccatccctgccacctcccccagctaatgacagcgatgccagccca
ggcggctgccaaggttcctaccgctgccaaccaggggtgctgctgcctgtgtgggaaccc
gacgacccatcactgggggacaaggctgcacgggccgtggtgtactttgtggccatggtc
tacatgttcttgggtctgtctatcattgctgatcgttttatggcatccattgaggtcatc
acatccaaggagaaagagatcaccatcaccaaggcaaatggggagaccagcgtgggcact
gtacgcatctggaatgaaacggtgtccaaccttacactcatggccctgggctcctcagca
cctgagattctgctgtctgtcatcgaggtctgtggccacaacttccaggcgggtgagcta
ggcccaggcaccatcgtgggcagtgccgccttcaacatgtttgtggtcattgctgtgtgt
gtgtatgtcatcccggctggtgagagccgtaagatcaagcacttaagggtcttcttcgtc
acagcctcttggagcatctttgcctatgtctggctttatctcattctagcagttttctct
ccaggcgtggtccaggtgtgggaggcactgctcacgctggtcttcttcccggtgtgtgtg
gtgttcgcctggatggcggacaagcgactgctcttctacaagtacgtgtacaagcgctat
cgcaccgaccctcgcagcggaatcatcatcggggcagagggagacccgcccaagagcatc
gagctggatggcacattcgtgggcactgaggtcccaggcgagctgggtgcattgggcaca
ggtcccgctgaggcgcgtgagctggacgccagccggcgcgaggtcatccagattcttaag
gacttaaagcagaagcacccggataaggacctggagcagctggtgggcatcgccaagtac
tatgcactgctgcaccagcagaagagccgtgccttctaccgcatccaggccacgcggctg
atgacaggtgcgggcaacgtgctgcgccgacacgctgcggatgctgcccgcaggcctggg
gccaacgatggtgcccccgatgatgaggacgatggtgccagccgcatcttctttgagccc
agcctctaccactgcctggagaactgcgggtcagtgctgctgtcggtggcttgccagggt
ggtgagggcaacagcaccttctacgtggattaccgcacggaggatggctctgcaaaggca
ggctccgattatgagtacagcgagggcacgctggtgttcaagcccggggagacgcagaag
gagctgcgcatcggcatcatcgacgacgacatcttcgaggaggacgagcacttcttcgtg
aggctgctgaacctgcgtgtgggcgatgctcagggcatgttcgagcccgacggcggtggg
cggcccaaggggcggctggtggcgccactgctggccaccgtcaccattctggacgacgac
cacgcgggcatcttctccttccaggaccgcctgctgcatgtgagcgagtgcatgggcacc
gtggatgtgcgtgtggtgcgcagctctggcgcacgtggcaccgtacgccttccctaccgc
acagtggacggcacggctcgtggtggtggtgtgcactacgaggatgcttgtggagagctg
gagttcggcgatgacgagaccatgaagactcttcaggtcaagatagtggacgacgaagag
tatgagaagaaggacaacttcttcatcgagctgggccagccccagtggcttaagcggggc
atctcagctctgctactcaaccaaggggatggagacaggaagctgactgcagaggaggag
gaggcccagaggatagcagagatgggcaagccagttcttggggagaactgtcgcctcgag
gtcatcatcgaggagtcttatgactttaagaatacggtggataaactcataaagaaaaca
aacctggccttggtgattgggacccactcatggagggagcagtttttagaggcagttaca
gtgagcgcaggggacgaggaggaggatgaggatgggtctcgtgaggagcggctgccatcc
tgctttgactacgtgatgcacttcctgacggtgttctggaaagttctgttcgcctgcctt
ccacccacggagtactgccatggctgggcctgctttggtgtctgcatcctggtcattggt
ctgctcactgccctcatcggagacctggcctcacactttgggtgcaccgtgggcctcaag
gactcagtcaacgccgtggtcttcgtggctctgggcacctccatccctgacacgtttgcc
agcaaggtggccgcgctgcaggaccagtgcgccgacgcgtccatcggtaacgtgaccggc
tccaatgcggtgaacgtgttcctgggcctgggtgtggcctggtcggtggccgcagtgtac
tgggcggtgcagggtcgccccttcgaggtgcgtacaggcacgctggccttctcggtcaca
ctgttcaccgtcttcgccttcgtgggcatcgcagtgctcttgtaccggcgccggccacac
atcggcggcgagctgggcggcccgcggggacccaagctagccaccaccgctctcttcctg
ggcctctggttcctctacattctcttcgccagcctggaggcttattgccacattcggggc
ttctag

DBGET integrated database retrieval system