KEGG   Rattus norvegicus (rat): 140590
Entry
140590            CDS       T01003                                 

Gene name
Bmpr2
Definition
(RefSeq) bone morphogenetic protein receptor type-2 precursor
  KO
K04671  bone morphogenetic protein receptor type-2 [EC:2.7.11.30]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04350  TGF-beta signaling pathway
rno04360  Axon guidance
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno05206  MicroRNAs in cancer
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    140590 (Bmpr2)
   04390 Hippo signaling pathway
    140590 (Bmpr2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    140590 (Bmpr2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    140590 (Bmpr2)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    140590 (Bmpr2)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    140590 (Bmpr2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    140590 (Bmpr2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    140590 (Bmpr2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     140590 (Bmpr2)
Protein kinases [BR:rno01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   140590 (Bmpr2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Activin_recp TCAD9 APH Cadherin_C_2
Other DBs
NCBI-GeneID: 140590
NCBI-ProteinID: NP_536332
RGD: 71082
Ensembl: ENSRNOG00000022196
UniProt: F1LQC5
Position
9
AA seq 1038 aa
MTSSLQRPFRVPWLLWAVLLVSTTAASQNQERLCAFKDPYQQDLGIGESRISHENGTILC
SKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCST
DLCNVNFTENFPPPDTTPLSPPHSSNRDETIIIALASVSVLAVLIVALCFGYRMLTGDRK
QGLHSVSMMEAAAAEPSLDLDNLKLLELIGRGRYGAVYKGSLDERPVAVKVFSFANRQNF
INEKNIYRVPLMEHDNIARFIVGDERLTADGRMEYLLVMEYYPNGSLCKYLSLHTSDWVS
SCRLAHSVTRGLAYLHTELPRGDHYKPAISHRDLNSRNVLVKNGGTCVISDFGLSMRLTG
NRLVRPGEEDNAAISEVGTIRYMAPEVLEGAVNLRDCESALKQVDMYALGLIYWEVFMRC
TDLFPGESVPDYQMAFQTEVGNHPTFEDMQVLVSREKQRPKFPEAWKENSLAVRSLKETI
EDCWDQDAEARLTAQCAEERMAELMMIWERNKSVSPTVNPMSTAMQNERNLSHNRRVPKI
GPYPDYSSSSYIEDSIHHTDSIVKNISSEHSMSSTPLTIGEKNRNSINYERQQAQARIPS
PETSVTSLSTNTTTTNTSGLTPSTGMTTISEMPYPDETHLHATNVAQSLGPTPVCLQLTE
EDLETNKLDPKEVDKNLKESSDENLMEHSLKQFSGPDPLSSTSSSLLYPLIKLAVEVTGQ
QDFTQAANGQACLIPDVPPAQLYPLPKQQNLPKRPTSLPLNTKNSTKEPRLKFGNKHKSN
LKQVETGVAKMNTINAAEPHVVTVTMNGVAGRSHNVNSHAATTQYANGVVPSGQAANIVA
HRAQEMLQNQFNGEDTRLNINSSPDEHEPLLRREQQAGHDEGVLDRLVDRRERPLEGGRT
NSNNNNSNPCSEQDVPTQGVTSTAADPGPAKPRRAQRPNSLDLSATNILDGSSMQIGEST
QDGKSGSGEKIKRRVKTPYSLKRWRPSTWVISTEPLDCEVNNNGSDRAVHSKSSTAVYLA
EGGTATTMVSKDIGMNCL
NT seq 3117 nt   +upstreamnt  +downstreamnt
atgacttcctcgctgcagcggccctttcgggtgccctggctgttatgggccgtcctgctg
gtcagcactacggctgcttcccagaatcaagaacggctgtgtgcatttaaagacccgtat
caacaagaccttgggattggtgagagtcgaatctctcatgaaaatgggacaatattatgc
tccaaagggagcacatgttatggtctgtgggagaaatcaaaaggggacatcaatcttgtg
aaacaagggtgctggtctcacattggtgatccccaagagtgccactatgaagaatgtgta
gtaactaccaccccaccctcaattcagaatggaacataccgtttttgctgctgtagtaca
gacttatgtaacgtcaacttcactgagaacttcccacctcctgatacaacaccactcagt
ccgcctcattcatctaatcgggatgaaactataatcattgctttggcatcggtttctgta
ttagctgttttgatagtcgccttatgttttggatacagaatgttgacaggagacaggaaa
cagggtctacacagtgtgagcatgatggaggcggcagcggcagagccctccctggacttg
gataacctgaagctgctggagctgattggacggggtcgatatggagcagtatataaaggt
tccttggatgagcgtccagttgctgtaaaagtattttcttttgcaaaccgtcagaatttt
ataaatgaaaaaaacatttacagagtgcctttgatggaacatgacaacattgctcgcttt
atagttggagacgagaggctcactgcagatggacgcatggagtatttgcttgtgatggag
tattatcccaatggatctctgtgcaaatatctgagtctccatacaagtgattgggtaagc
tcttgccgtctggctcattctgtgacaagaggactggcttatcttcacacagaattaccc
cgaggagatcattacaaacctgcaatttcccatcgagatttaaacagcagaaatgtcctg
gtaaagaatggtggcacgtgtgttatcagtgactttggtctgtccatgaggctaactgga
aacaggctggtgcgcccaggggaagaagataacgcggctataagtgaggttggcacaatc
cgctatatggcaccagaagtgctagaaggagctgtgaacctgagggactgtgagtcagca
ctgaagcaagtggacatgtatgcgcttggactgatctactgggaggtgtttatgaggtgc
acagacctcttcccaggtgaatctgtaccagattaccagatggcttttcagacagaagtt
ggaaaccatcccacatttgaggatatgcaggttcttgtgtcaagagaaaagcagagaccc
aagttcccagaagcctggaaagaaaatagcctggcagtgaggtcactcaaagaaacaatc
gaagactgctgggaccaggatgcagaggctcggctcactgcacagtgtgctgaggagaga
atggctgaactcatgatgatatgggagagaaacaagtctgtgagcccaacggtcaaccca
atgtcgactgctatgcagaacgaacgcaacctatcacataataggcgtgtgccaaaaatc
gggccttacccagattattcctcttcctcatatattgaagactcaattcatcacactgac
agcattgtgaaaaatatttcctctgagcattcaatgtccagcacaccgttgacaatagga
gaaaagaaccgaaactcaattaattatgaacgacagcaagcacaagctcgaatccctagc
ccagaaacaagcgtcacaagcctgtccacaaacacaaccaccacaaacacctctggcctc
actccaagtactggcatgaccacgatatctgagatgccatacccagatgagacacatttg
catgccacaaatgttgcacagtcactcgggccaacccctgtctgcttacagctgacagaa
gaagacttggaaactaataagctagacccaaaagaagttgataagaacctcaaggaaagc
tctgatgagaatctcatggagcattctctgaagcagttcagtgggccagacccgttgagc
agtaccagttccagcttgctttatccactcataaagcttgcggtggaagtgactggacaa
caggacttcacacaggctgcaaatgggcaagcatgtttaattcctgatgtcccacctgct
cagctctatcctctccctaagcaacagaaccttccgaagagacctactagtttgcctttg
aacaccaaaaattcaactaaagaaccccggctaaaatttggcaacaagcacaaatcaaac
ttgaaacaagtagaaactggagttgccaagatgaatacaatcaatgcagcagagcctcat
gtggtgacagtaactatgaatggtgtggcaggtagaagccacaatgttaattcccatgct
gccacaacccagtatgccaatggggtagtgccatctggccaggcagccaacatagtggca
catagggcccaagaaatgctgcagaatcaatttaatggtgaggataccagactgaatatc
aattccagtcctgatgaacatgaacctttactgagacgagagcagcaggctggccatgat
gaaggggttctggatcgtttggtagacaggagggaacggccattagaaggtggccgaact
aattccaataacaacaacagcaatccatgttcagaacaagatgtccctacacaaggtgtt
acaagcacagctgcagaccctgggccagcaaagcccagaagagcacagaggcccaattct
ctggatctttcagccacaaatatcctggatggcagcagcatgcagataggtgagtcaacg
caggatggcaaatcaggatcaggcgaaaagatcaagagacgtgtgaaaactccatactct
cttaagcggtggcgcccatccacctgggtcatctccaccgagccactggactgtgaggtc
aacaacaatggcagtgacagggcagtccattctaaatctagcactgctgtgtacctcgca
gagggaggcactgccacaaccatggtgtctaaagatataggaatgaattgtctgtga

KEGG   Rattus norvegicus (rat): 29263
Entry
29263             CDS       T01003                                 

Gene name
Acvr2a
Definition
(RefSeq) activin receptor type-2A precursor
  KO
K04670  activin receptor type-2A [EC:2.7.11.30]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04350  TGF-beta signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    29263 (Acvr2a)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    29263 (Acvr2a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    29263 (Acvr2a)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    29263 (Acvr2a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    29263 (Acvr2a)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     29263 (Acvr2a)
Protein kinases [BR:rno01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   29263 (Acvr2a)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Activin_recp Pkinase_fungal APH Dynein_IC2
Other DBs
NCBI-GeneID: 29263
NCBI-ProteinID: NP_113759
RGD: 70911
Ensembl: ENSRNOG00000005334
Vega: OTTRNOG00000002257
UniProt: P38444
Position
3
AA seq 513 aa
MGAAAKLAFAVFLISCSSGAILGRSETQECLFFNANWERDRTNQTGVEPCYGDKDKRRHC
FATWKNISGSIEIVKQGCWLDDINCYDRTDCIEKKDSPEVYFCCCEGNMCNEKFSYFPEM
EVTQPTSNPVTPKPPYYNILLYSLVPLMLIAGIVICAFWVYRHHKMAYPPVLVPTQDPGP
PPPSPLLGLKPLQLLEVKARGRFGCVWKAQLLNEYVAVKIFPIQDKQSWQNEYEVYSLPG
MKHENILQFIGAEKRGTSVDVDLWLITAFHEKGSLSDFLKANVVSWNELCHIAETMARGL
AYLHEDIPGLKDGHKPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAGKSAGDTHGQV
GTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELASRCTAADGPVDEYMLPFEEEIG
QHPSLEDMQEVVVHKKKRPVLRDYWQKHAGMAMLCETIEECWDHDAEARLSAGCVGERIT
QMQRLTNIITTEDIVTVVTMVTNVDFPPKESSL
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgggagctgctgcaaagttggcgttcgccgtctttcttatctcttgctcttcaggtgct
atacttggcagatcggaaactcaggagtgtcttttctttaatgctaattgggaaagagac
agaaccaatcagactggtgttgagccttgctatggtgataaagacaaacgacgacattgt
tttgctacctggaagaatatttctggttccattgaaatagtaaagcaaggttgttggctg
gatgatatcaactgctatgacaggactgattgtatagaaaaaaaagacagccctgaagtg
tacttttgttgctgtgagggcaatatgtgtaatgaaaagttctcttattttccggagatg
gaagtcacacagcccacatcaaatcctgttaccccgaaaccaccctactacaacatcctg
ctgtattccttggtaccacttatgttaattgcggggattgtcatttgtgcgttttgggtg
tacagacatcacaagatggcctaccctcctgtacttgttcctactcaggaccctggacca
cctccaccttccccattactagggttgaagccattgcagctattggaagtgaaagcaagg
ggaagatttggttgtgtctggaaagcccagttgctcaatgagtatgtggctgtcaaaata
tttccgatacaggacaaacagtcctggcagaatgaatatgaagtctatagtttacctggt
atgaagcatgaaaacatactacagttcattggtgcagagaaaagaggcaccagtgttgat
gtggacctgtggctaatcacggcttttcatgaaaagggctcactgtcagactttcttaag
gctaatgtggtctcttggaatgaactttgtcatattgcagaaaccatggctagaggattg
gcatatttacatgaggatatacctggcttaaaagatggccacaagcctgcaatatctcac
agggacataaaaagtaaaaatgtgctgttgaaaaacaatctgacagcttgcattgctgac
tttgggttggccttaaagtttgaggctggcaagtctgcaggtgacacccatggccaggtt
ggtacccggaggtatatggctccagaggtgttagagggtgctataaacttccaaagggac
gcatttctgaggatagatatgtacgccatgggattagtcctgtgggaactggcttctcgt
tgtactgctgcagatggacctgtagatgagtacatgttgccatttgaggaggaaattggc
cagcatccatctcttgaagatatgcaggaagttgttgtgcataaaaaaaagaggcccgtt
ttaagagattattggcagaaacacgcaggaatggcaatgctctgtgaaacgatagaagaa
tgctgggatcatgatgcagaagccaggttatcagctggatgtgtaggtgaaagaattact
cagatgcaaagactaacaaatataattactacagaggacattgtaacagtggtcacaatg
gtgacaaatgttgactttcctcccaaagaatctagtctatga

DBGET integrated database retrieval system