KEGG   Rattus norvegicus (rat): 140592
Entry
140592            CDS       T01003                                 

Gene name
Ppfia4
Definition
(RefSeq) PTPRF interacting protein alpha 4
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: SAM_1 SAM_2
Other DBs
NCBI-GeneID: 140592
NCBI-ProteinID: NP_536334
RGD: 620055
Ensembl: ENSRNOG00000003494
UniProt: Q91Z80
Position
13q13
AA seq 1185 aa
MCEVMPTINEGDPLGPPHGADADANFEQLMVNMLDEREKLLESLRESQETLVATQSRLQD
ALHERDQLQRHLNSALPQEFATLTRELSMCREQLLEREEEISELKAERNNTRLLLEHLEC
LVSRHERSLRMTVVKRQAQSPSGVSSEVEVLKALKSLFEHHKALDEKVRERLRAALERVT
TLEEQLAGAHQQVSALQQGAGIRDGVAEEEETVDLGPKRLWKDDTGRVEELQGLLEKQNY
ELSQARERLVTLSATVTELEEDLGTARRDLIKSEELSGKHQRDLREALAQKEDMEERITT
LEKRYLAAQREATSIHDLNDKLENELANKESLHRQCEEKARHLQELLEVAEQKLQQTMRK
AETLPEVEAELSQRIAALTKAEERHGNIEEHLRQLEGQLEEKNQELARVRQREKMNEDHN
KRLSDTVDRLLSESNERLQLHLKERMAALEEKGRLSEEIEKLRQEVDQLKGRGGPFVDGI
HSRSHVGSTTDVRFSLSTAAHVPPGLHRRYTALREESAKDWKPAPLPGVLAATTTPAFDS
DPEISDVDEDEPGGLVGTQVDVISPGGHSDAQTLAMMLQEQLDAINQEIRMIQEEKESTE
LRAEEIETRVTSGSMEALNLTQLRKRGSIPTSLTALSLASASPPLSGRSTPKLTSRSAAQ
DLDRMGVMTLPSDLRKHRRKLLSPVSREENREDKATIKCETSPPSSPRTLRLEKLGHPTL
SQEEGKSALEGQDSNPSSSNSSQDSLHKGAKRKGIKSSIGRLFGKKEKGRLIHLSRDATG
HVLLTDSELSLQEPMVPAKLGTQAEKDRRLKKKHQLLEDARRKGMPFAQWDGPTVVSWLE
LWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNALHRLKLRLAIQEMVSLTSPS
APPTSRTSSGNVWVTHEEMETLATSTKTDSEEGSWAQTLAYGDMNHEWIGNEWLPSLGLP
QYRSYFMECLVDARMLDHLTKKDLRVHLKMVDSFHRTSLQYGIMCLKRLNYDRKELEKRR
EESQHEIKDVLVWTNDQVVHWVQSIGLRDYAGNLHESGVHGALLALDENFDHNTLALVLQ
IPTQNTQARQVMEREFNNLLALGTDRKLDDGEEKVFRRAPSWRKRFRPRDHHSGGMLGTS
AETLPAGFRVSTLGPLQPPPAPPNKIMPEAHSHYLYGHMLSAFRD
NT seq 3558 nt   +upstreamnt  +downstreamnt
atgtgtgaggtgatgcccacaatcaatgagggggaccctctggggcccccccacggtgcc
gatgctgacgccaactttgagcagttgatggtgaacatgctggatgagcgagagaagttg
ctggagtcccttcgggagagtcaggaaactttggtagccacacagagccggctccaagat
gcccttcacgagcgagaccagctccagcgccacctgaactctgcccttccccaggaattt
gccacattaactcgggagctaagcatgtgtcgggagcagcttctggagcgggaggaagag
atatctgagctgaaagcagaacggaataacactaggctgcttctggaacatctggaatgc
ctcgtgtcccgccatgagcggtcattgcgaatgacagtggtaaaacgccaggcccagtca
ccttcaggtgtctccagtgaggtggaggtgctgaaggccctcaagtcactatttgagcac
cacaaggccctggatgagaaggttcgagagcggctccgggcagctctagagcgagttacc
accttggaggagcagttggcaggagctcaccagcaggtgtctgccctgcagcagggggca
ggaattcgggatggagtggcagaagaggaagaaactgtggatctgggaccaaaacgcctg
tggaaagatgacactggccgtgtggaagaactgcaagggctcttggagaagcaaaactat
gagttgagccaggcccgggagcggctggtcaccctgagtgcaactgtgactgagcttgag
gaggacctgggcacagcccgccgagacctcatcaagtcagaggagctgagtggcaagcat
cagcgcgacctccgagaggctctggctcagaaggaggacatggaagagcgaatcaccacc
ctggagaagcgctacttggctgctcagcgagaggccacatccatccatgacctcaatgac
aaactggagaatgagctagccaacaaggagtccctgcaccgccagtgtgaggagaaagcc
cggcatctgcaggagctgttggaagtggcagagcagaagctgcagcagaccatgcgcaag
gcagagaccctgccagaggtggaggccgagctgtctcagagaattgcagctctcaccaag
gctgaggaacgtcatggcaacattgaggaacatctgcggcagctggaagggcagctggag
gagaagaaccaggagctggcaagggtgcgccagcgggagaagatgaacgaggaccacaac
aagcggctgtcagacactgtggaccggttgcttagtgagtccaacgagcgcctgcagctc
cacctcaaggagcgaatggctgccctggaggagaagggccgtctgtctgaggagattgag
aagcttcgccaagaggtggaccagctgaagggtcgaggggggccgtttgtggatggcatc
cactccaggtcacacgtgggcagtacaacagatgtgcggttctcactgagtacagccgcg
cacgtgcctccaggtctgcatcgtcgctatacggctctgagggaagagtctgccaaggac
tggaagccggcaccactgccgggggtgttggctgccaccaccacgcctgcctttgacagt
gaccctgagatctccgatgtggacgaggatgagcctggtggcttggtgggcactcaggtt
gatgtcatctcacctggtggccattctgatgcccaaaccctggccatgatgctccaggaa
caactggatgccatcaaccaggagatcaggatgattcaggaggagaaggaatccactgag
ctgcgtgctgaagagattgagacccgtgtgaccagcggcagcatggaggccctcaacctg
acccagctgcgcaagcgtggctccatccccacctctctgaccgccctgtccctggccagt
gcatctccaccactcagtggccgctccacacccaagctcacttccagaagtgctgcccag
gacctggaccgaatgggggtcatgaccctgcccagcgacttaagaaagcataggaggaag
ctgctgtcgccagtgtctcgggaagagaaccgagaggataaagccaccataaaatgtgag
acttctcctccttcctcacccaggacgctgcggctagagaagcttggccaccctaccctg
agtcaagaagaaggcaagagtgccttggagggccaggacagcaaccccagcagcagcaac
agcagccaggactccctgcacaagggcgccaagcgcaagggcatcaagtcgtccattggc
cgcctgtttgggaagaaggagaagggcaggctgatccacttgagtcgggatgccacaggc
catgttctgctcacagactccgagctcagtctgcaggaaccaatggtacctgccaaattg
gggacccaggcagagaaggaccggcgactgaaaaagaaacaccagctgcttgaagatgct
cgcagaaaaggaatgccttttgcccaatgggatggccccacggtggtctcctggctggag
ctctgggtggggatgcctgcttggtatgtggcggcctgccgggccaatgtcaagagtgga
gccatcatgtctgccctgtcagacacggagatccagcgggagatcggcatcagcaatgcc
ctgcacaggctcaagctccgcctggccatccaggagatggtgtcactgacgagcccctca
gccccgcctacctcaaggacatcttcagggaatgtctgggtgacccacgaagagatggaa
actctggcaacgtctaccaaaacagacagtgaggagggcagttgggcccagaccctggcc
tacggagatatgaatcacgaatggattggaaatgaatggctgcccagcctggggctccct
cagtaccgcagttacttcatggagtgcctagtggatgcacgcatgctggatcacctcacc
aagaaggacctgcgtgtccacctcaagatggtggacagtttccatagaaccagtcttcag
tatggcatcatgtgtctgaagaggctgaactatgaccggaaggagctggagaagaggcgg
gaagagagccagcatgagatcaaggatgtgctggtctggaccaatgaccaggtggttcac
tgggtccagtccatagggctaagggattatgccggaaacctacatgaaagtggtgtgcat
ggtgccctgctggccttggatgaaaacttcgaccacaacacattggccttggttctgcag
atccccacacagaacacccaggcccgccaagtgatggagagagagttcaataacctgttg
gccttgggcacagacaggaaattggatgacggggaagagaaggtgttccgtcgagcaccc
tcctggaggaaacgctttcggcctcgggatcaccatagcggtggcatgttgggcacctca
gcggagaccctccctgcgggcttccgtgtgtccaccctgggtccgctgcagcctccaccc
gccccgcccaacaagatcatgccggaagctcactcccactatctctacggacacatgctc
tccgccttccgggactag

DBGET integrated database retrieval system