KEGG   Rattus norvegicus (rat): 140635
Entry
140635            CDS       T01003                                 

Gene name
Flt3
Definition
(RefSeq) receptor-type tyrosine-protein kinase FLT3 precursor
  KO
K05092  fms-related tyrosine kinase 3 [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04640  Hematopoietic cell lineage
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05221  Acute myeloid leukemia
rno05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    140635 (Flt3)
   04014 Ras signaling pathway
    140635 (Flt3)
   04151 PI3K-Akt signaling pathway
    140635 (Flt3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    140635 (Flt3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    140635 (Flt3)
   05202 Transcriptional misregulation in cancer
    140635 (Flt3)
   05230 Central carbon metabolism in cancer
    140635 (Flt3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    140635 (Flt3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    140635 (Flt3)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    140635 (Flt3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     140635 (Flt3)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   140635 (Flt3)
CD molecules [BR:rno04090]
 Proteins
  140635 (Flt3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase ig Ig_3 I-set Ig_2 APH Haspin_kinase TCAD9
Other DBs
NCBI-GeneID: 140635
NCBI-ProteinID: NP_001094292
RGD: 61308
Ensembl: ENSRNOG00000054764
Position
12
AA seq 1000 aa
MRALARRSDRLPLLVVLSVMILETVTNQDLPVIKCVLIIHKNNGSAAGKSSSHVMVPESP
EDLRCAPKHRSEGVVYEAVTVEVAQSASFTLQVQLTTPGDVSCLWVFKHSSLGCQPHFDL
QNRRIVSMTILNVTETQAGEYLLHIQSEATNHTVLFTVNVRDTQLYVLRRPSFRKMENQD
ALLCVSEGVPEPTVEWVVCSSHRDSCREEGSAVVKKEEKVLHELFETDIRCCARNALGRE
CTKLFTIDLNQAPQSTLPQLFLKVGEPLWIRCKAIHVNHGFGLTWELGNKVLEEGSYFEM
SSYSTNRSMIRILLAFVSSVGRNNTGYYTCSSSKHPSQTALVTILEKGFINATSSQEEYE
IDPYEKFCFSVRFKAYPQIRCKWTFSQTSFPCEQSGLEDGYSISKFCDHKNNPGEYIFHG
ENDDAQFTKMFILNIRRKPQVLANASASQASCFSDGYPLPNWTWKKCSDKSPNCTEEIPE
GVWNKKANRKVFGQWVSSSTLNMSEAGRGFLVKCCAYNSMGTSCETILLNSPGPFLFIQD
NISFYATIGLCPPFIVVLTVLICHKYKKQFRYESQLQMIQVTGPLDNEYFYIDFRDYEYD
LKWEFPRENLEFGKVLGSGAFGRVMNATAYGISKTGVSIQVAVKMLKEKADRCEREALMA
ELKMMTHLGHHDNIVNLLGACTLSGPVYLIFEYCCHGDLLNYLRSKREKFHRTWTEIFKE
HNFSFYPTFQSHSNSSMPGSREVQIYPPVDQVSGFNGNSIHSEGNIEYENQKRLEEEEEE
DLNVLTFEDLLCFAYQVAKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARDILS
DSSYVVRGNARLPVKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANF
YKLIQSGFKMEQPFYATEEIYFVMQSCWAFDSRKRPSFPNLTSFLGCQLAEAEAAMYQNM
GGDVPLEHPAIYQNRRPASREAGSEPPSPQVQEKTHRERS
NT seq 3003 nt   +upstreamnt  +downstreamnt
atgcgggcgttggcgcggcgcagcgaccggctgccgctgcttgttgttttgtcagtaatg
attctcgagaccgttacaaaccaagatctgcctgtgatcaagtgtgttttaatcattcat
aagaacaatggctcggcggcgggaaagtcatcgtcgcacgtcatggttccagaatcccca
gaggacctccggtgtgccccgaagcatcggagtgaaggggtggtctatgaagctgtcact
gtggaggtggcccagtctgcgtccttcacattgcaagtacagctcaccaccccgggggat
gtttcttgcctctgggtctttaagcacagctcgctgggctgccagccacactttgattta
cagaacagaagaattgtttccatgaccatcttgaacgttacagagacccaggcaggagaa
tacctactccatattcagagtgaagccaccaaccacacggtgctgttcacagtgaatgta
agagatacacagctgtacgtgctaagaagaccttccttcagaaagatggagaaccaggac
gccctgctctgcgtctctgagggtgtcccagagcccaccgtggagtgggtggtctgcagt
tcccacagggacagctgtagagaagaaggctctgccgttgtcaaaaaggaggaaaaggta
cttcacgagctatttgaaacagacatcagatgctgtgcgagaaatgcactgggccgagaa
tgcaccaagctgttcaccatagatctaaaccaggctcctcagagcacactgccccagtta
tttctgaaagtgggggagcccttgtggataaggtgcaaggccatccatgtgaaccatgga
ttcgggctcacctgggagctgggaaacaaagtcctggaggagggcagctactttgagatg
agttcctactccaccaacagatccatgatccggattctcttggcttttgtgtcctctgtg
ggaaggaacaacaccggatattacacctgttcttcctcaaagcatcccagccagacagcg
ttggtgaccatcctagaaaaaggtttcataaatgctaccagctcacaagaagagtatgaa
attgacccgtatgaaaagttctgcttctcggtcaggtttaaagcgtacccacaaatccga
tgcaagtggaccttctctcaaacatcgtttccttgtgaacaaagtggcctggaggatggg
tacagcatttctaaattttgcgatcataagaacaacccaggagaatacatattccatgga
gaaaatgatgacgcccagttcaccaaaatgttcatactgaatataagaaggaaacctcaa
gtgctagcaaatgcctcagccagccaggcatcctgtttctctgatggctacccgttaccc
aactggacctggaagaagtgttcggacaagtcacccaactgcacggaggaaatcccagaa
ggagtttggaataaaaaggctaacagaaaagtgtttggacagtgggtgtcgagcagtacc
ctgaatatgagtgaggccgggagagggtttctggtcaaatgctgtgcatacaattctatg
ggcacgtcttgcgaaaccatccttttaaactcaccaggccccttccttttcatccaagac
aacatctccttctatgcaaccatcgggctttgcccgcctttcattgtcgtcctcactgtg
ctgatctgtcacaaatacaaaaagcaatttaggtacgaaagccagctgcagatgatccaa
gtgaccggccccctggataacgagtacttctacattgacttcagggactacgaatatgac
ctcaagtgggagtttccaagggaaaacttagagtttgggaaggtcctggggtccggcgct
tttgggagagtgatgaatgccacggcctacgggattagtaaaacaggagtctcaattcag
gtggcggtgaagatgctaaaagagaaagctgacagatgtgaaagagaggcgctcatggct
gagctcaaaatgatgacccacctggggcaccatgacaacatcgtgaacctgctgggggca
tgcacactgtcagggccagtgtacttgatttttgaatattgttgccatggtgacctgctc
aactacctaagaagcaaaagagaaaagtttcacaggacgtggacagagatttttaaggaa
cataatttcagtttttaccccaccttccagtcacattcaaactccagtatgccgggttca
cgagaagttcagatatacccgcccgtggatcaggtctcagggttcaatgggaattcaatt
cattctgaaggtaatattgagtatgaaaaccagaagaggctggaagaagaggaggaagaa
gatttgaacgtgctgacgtttgaagacctcctttgttttgcgtatcaagtggccaagggc
atggagttcctggagttcaagtcgtgtgttcacagagacctggcagccaggaacgtactg
gtcacccacgggaaggtggtgaagatctgtgactttggactggcccgagacatcctgagt
gactccagctacgtcgtcaggggcaacgcacggctgccagtgaagtggatggcacctgag
agcttgtttgaagggatctatacaatcaagagtgacgtctggtcctacggcatccttctc
tgggagatattttcattgggtgtgaacccttaccccggtattcctgtcgatgctaacttc
tataaactgattcagagtggatttaaaatggagcagccgttctatgctacggaagagata
tactttgtaatgcaatcctgctgggcttttgactcaaggaagcggccatccttccccaat
ctgacgtcatttttaggctgtcagctcgcagaggcagaagcagcgatgtatcagaacatg
ggcggcgatgtcccactggagcacccagccatctaccaaaacaggcggcctgccagcaga
gaggcaggctcagagccgccatcaccacaggttcaggagaagactcacagagaaagaagt
tag

DBGET integrated database retrieval system