KEGG   Rattus norvegicus (rat): 140656
Entry
140656            CDS       T01003                                 

Gene name
A1bg
Definition
(RefSeq) alpha-1B-glycoprotein precursor
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig
Other DBs
NCBI-GeneID: 140656
NCBI-ProteinID: NP_071594
RGD: 69417
Ensembl: ENSRNOG00000004692
Vega: OTTRNOG00000002402
UniProt: Q9EPH1
Position
7
AA seq 513 aa
MSLLTTVLLLWGFTLGPGNALWLNSGSEPELRAEPQSLLEPWANLTLVCAVDLPTKVFEL
IMNGWFLSQVRLETPVLSYRFSLGAITSNNSGVYRCRCGVEPPVDIQLPALSKWTMLSNA
LEVTGKEPLPPPSAHADPVSWITPGGLPVYIMCRVAMRGVTYLLRKEGVDGTQKPDVQHK
GTAGFLIYKPGNYSCSYLTHAGGEPSEPSAIVTIKMSATQLPPSLCLMGSYLTIYPQKTH
ETLACKAPRNAAEFQLRQGERVLNIQGFSPTRDATIYYVNLKELDNQSPFTCRYRMHKYM
HVWSEDSKPVELMWSDEKLPAPVLTAEPSSHNLEPGSTVQLRCTAHKAGLRFGLQRQGKP
DLVVVQMLNSSGTEAVFELHNISTIDSGNYSCIYMEQAPPFSGSASSEPLELRINGPAPK
PRLEALWKGKVPLGHEAIFQCHGHVPRVSMELVREGFKTPFWMASTTSTSAFLKLSFVGP
QHTGNYSCRYTALSPFTFESGISDPVEVVVEGS
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgtctctgttgactactgtactacttctctggggtttcactctgggcccaggaaatgct
ctttggcttaattctggcagtgaacctgaactacgggcagagcctcaatccttgctggaa
ccctgggcaaacctcacactggtctgcgcagttgatttgcctaccaaggtcttcgagctg
atcatgaatgggtggttcctgagtcaagtccgactggagacaccggtgttgtcatatcgc
ttttccctgggggccattacaagtaacaacagtggcgtctaccgctgccgatgtggcgtg
gaaccccctgttgacattcaactgccagcgctgagcaagtggacaatgctaagcaatgct
ttggaggtgacagggaaagagcccttgcctccaccctcagctcacgctgatccagtctcc
tggatcacacctggtggcctgcctgtctacatcatgtgccgggttgccatgcgaggtgta
acctacctgctgaggaaggaaggggtggatggtacccagaaacctgatgtccagcacaag
ggaacggctggctttctaatctacaagcctggtaactacagctgcagctacctaacccat
gcaggaggcgaaccctctgagcccagtgctattgtgaccatcaagatgtctgccacacag
cttccacccagtctgtgtttaatgggaagttacctaacgatctacccccagaagacacat
gagacgcttgcttgcaaagctcctcggaatgcagccgaattccaactcagacaaggagag
agggtgctgaatattcaagggttcagccccaccagagatgctaccatatactatgtgaac
ttgaaggaactggataaccaaagtccttttacctgccgctaccgtatgcacaaatacatg
catgtttggtcggaggacagcaagcccgtagagctgatgtggagtgacgagaaactacca
gccccggtactcactgcagagccatcaagtcacaacctggagcctggttcaacagtgcag
cttcgatgtactgcacacaaggctggcctgcgctttggcctgcaacgccagggcaaacca
gatttagttgtggtgcagatgctgaattcgtctgggaccgaagctgtctttgagctgcac
aatatctcaacaatcgactctggcaactacagttgtatctacatggaacaagcaccaccc
ttctcaggatctgcttccagtgagcccttagagctgcggataaatgggccagcacccaag
ccaaggctggaagctctgtggaaaggcaaggttcctctgggccatgaagccatctttcaa
tgccatggccatgtgcccagggtcagcatggagctggtacgtgagggctttaaaacaccc
ttctggatggcttcaacaacaagcacctcagcttttctgaagctgtccttcgtcggtccc
caacatacaggcaactacagctgccgctatactgccctgtcacccttcacatttgaatca
gggatcagtgaccctgtggaagttgtagtagaaggtagctaa

DBGET integrated database retrieval system