KEGG   Rattus norvegicus (rat): 140657
Entry
140657            CDS       T01003                                 

Gene name
Faf1
Definition
(RefSeq) Fas associated factor 1
  KO
K20703  FAS-associated factor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    140657 (Faf1)
SSDB
Motif
Pfam: UBX UBA_4 ubiquitin AAA_23 Borrelia_P83
Other DBs
NCBI-GeneID: 140657
NCBI-ProteinID: NP_569090
RGD: 70987
Ensembl: ENSRNOG00000008523
UniProt: Q924K2
Position
5q35
AA seq 649 aa
MASNMDREMILADFQACTGIENIDEAITLLEQNNWDLVAAINGVIPQENGILQSDFGGET
MPGPTFDPASPPAPAPAPSSSAFRPVMPSRQIVERQPRMLDFRVEYRDRNVDVVLEDSCT
VGEIKQILENELQIPVPKMLLKGWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSSS
HAGALQESLNQNFMLIITHREVQREYNLNFSGSSTVQEVKRNVYDLTSIPVRHQLWEGWP
ASATDDSMCLAESGLSYPCHRLTVGRRTSPVQTREQSEEQSTVVHMVSDSDGDDFEDASE
FGVVDGEVFGMASSTMRKSPMMPENAENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAAF
QEAFYVKARDRKLLAIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTKDANR
ARFLTMCNRHFGSVIAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELMMRLM
AAMEIFSAQQQEDIKDEDEREARENVKREQDEAYRLSLEADRAKREAHEREMAEQFRLEQ
IRKEQEEEREAIRLSLEQALPPEPEEENAEPVSKLRIRTPSGEFLERRFLASNKLQIVFD
FVASKGFPWDEFKLLSTFPRRDVTQLDPNKSLLEVNLFPQETLFLLAKE
NT seq 1950 nt   +upstreamnt  +downstreamnt
atggcgtccaacatggaccgggagatgatccttgcggattttcaggcatgtactggtatt
gaaaacattgatgaagctattacactgcttgagcaaaataactgggacttggtggcagct
atcaatggtgtaataccccaggaaaatggcattctacaaagtgactttggaggtgagacc
atgccaggacccacatttgacccagcaagtccacctgctccagctccagctccctcttct
tccgcgttccgacctgtaatgccatccaggcagatcgtagaaaggcagccgcgcatgctc
gacttcagagttgaatacagggacaggaatgttgatgtggtacttgaagacagctgtact
gttggagagattaaacagattctagaaaatgaacttcagatacctgtgcctaaaatgctg
ttgaaaggctggaagactggagatgtggaagacagtacggtcttaaaatcactacacttg
ccaaaaaacaacagtctttatgtccttacaccagacttaccaccaccttcatcatccagt
catgctggtgccctgcaggaatcattaaatcaaaacttcatgctgatcatcacccaccga
gaggtccagcgggagtacaacctgaacttctcaggaagcagtaccgttcaagaggtaaag
agaaatgtgtatgatctgacaagcatacctgttcgacatcagttatgggaaggctggcca
gcttctgccactgatgattcaatgtgtcttgctgaatcagggctctcttatccctgccat
cgactcactgtgggacgaagaacttcacctgtacagacccgtgagcaatcagaagagcaa
agcacggtagttcatatggttagtgatagtgatggagatgactttgaagatgcttcagaa
tttggagtggtagacggagaagtatttggcatggcatcatctaccatgagaaaatctcca
atgatgccagaaaacgcagaaaatgaaggagatgccttattacaatttacagcagagttt
tcttcaagatatggtgactgccatcctgtattttttattggctcattagaagctgctttc
caagaggccttctatgtgaaagccagagacagaaagcttcttgctatctacctccaccat
gatgaaagtgtactaaccaacgtgttctgctcacaaatgctttgtgctgaatccattgtt
tcttatctgagtcaaaattttataacctgggcttgggatctgacaaaggacgccaacaga
gcaagatttctgacaatgtgcaatagacactttggcagcgttattgcacaaaccattcgg
actcaaaagacagatcagtttccacttttcctgattatcatgggaaagcgatcatctaat
gaagtgctaaatgtgatacaaggtaatacaacagtggatgagttaatgatgagactcatg
gctgccatggagattttctcagctcaacaacaggaagacataaaggatgaggatgaacgt
gaagccagagaaaatgtgaagagagagcaagatgaggcttatcgcctttcccttgaagcc
gacagggcaaagagagaagctcatgagagagagatggcagaacagtttcgtttggagcag
attcgcaaagagcaagaagaggaacgcgaggccatcagactctccttagaacaagccctg
cctccagagccagaggaggaaaatgcggagcctgttagcaagcttcggattcgaaccccc
agtggcgagttcctggaacgccgtttcctggccagcaataagctccagattgtctttgat
tttgtggcttccaagggatttccttgggatgagttcaagttactgagcacctttcctagg
agagacgtaactcagctagaccccaataagtcattattggaggtaaacttgttccctcaa
gaaacccttttccttctagcaaaagagtaa

DBGET integrated database retrieval system