KEGG   Rattus norvegicus (rat): 140667
Entry
140667            CDS       T01003                                 

Gene name
Ap3m2
Definition
(RefSeq) AP-3 complex subunit mu-2
  KO
K12398  AP-3 complex subunit mu
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    140667 (Ap3m2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    140667 (Ap3m2)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Others
   AP-3 complex
    140667 (Ap3m2)
 Endosome - Golgi transport
    140667 (Ap3m2)
SSDB
Motif
Pfam: Adap_comp_sub Clat_adaptor_s DUF11
Other DBs
NCBI-GeneID: 140667
NCBI-ProteinID: NP_579839
RGD: 70969
Ensembl: ENSRNOG00000018650
UniProt: P53678
Position
16
AA seq 418 aa
MIHSLFLINSAGDIFLEKHWKSVVSRSVCDYFFEAQERATEAENVPPVIPTPHHYLLSVY
RHKIFFVAVIQTEVPPLFVIEFLHRVVDTFQDYFGVCSEPVIKDNVVVVYEVLEEMLDNG
FPLATESNILKELIKPPTILRTVVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAY
FDVVEEIDAIIDKSGSTVTAEIQGVIDACVKLTGMPDLTLSFMNPRLLDDVSFHPCVRFK
RWESERILSFIPPDGNFRLLSYHVSAQNLVAIPVYVKHSISFRDSGSLGRFEITVGPKQT
MGKTIEGVTVTSQMPKGVLNMSLTPSQGTHTFDPVTKMLSWDVGKINPQKLPSLKGTMGL
QVGASKPDENPTINLQFKIQQLAISGLKVNRLDMYGEKYKPFKGIKYMTKAGKFQVRT
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgattcacagtcttttcttgatcaactctgctggggatattttcctggagaagcactgg
aaaagcgtggtcagccgctctgtttgcgattactttttcgaggcccaagagagagctacg
gaggctgaaaatgtgcctcccgtcatccccacacctcaccactaccttctgagcgtttac
cggcacaagatcttctttgtggctgtgatccagacggaggtcccgcctctgtttgtcatt
gaattccttcaccgagtagtggacacatttcaggactatttcggggtctgctctgagcca
gtgatcaaagacaacgtggtggtggtctacgaggtgttggaagagatgctggacaatggg
ttccccttggctacggagtcgaacatcctcaaggagctgataaagcctcccaccattctc
cggacagtagtcaacaccatcacaggaagcaccaatgtgggcgaccagcttccaactggg
cagctgtcggtggtgccttggcgacggactggggtgaaatataccaacaacgaggcctat
ttcgacgtggttgaagagatagacgccatcattgacaaatcaggttccacagtcaccgct
gagatccaaggggtgattgatgcctgtgttaaactgaccgggatgccagatctcacgctg
tccttcatgaaccccaggttgctggatgatgttagcttccacccctgtgtccgtttcaag
cgctgggaatctgagcgcatcctctccttcatccctcctgacggcaacttccgcctgctc
tcctaccacgtcagtgcacagaacctagttgccattccagtctatgtcaaacacagcatc
agcttccgggacagtggctcacttggacgctttgaaatcacagtggggccgaagcagacc
atggggaagaccatagagggtgtgactgtaaccagccagatgcccaaaggagtcttgaac
atgagcctcactccatcccaggggacacacacgtttgacccggtgacaaagatgctgtct
tgggatgtaggaaaaataaacccgcaaaagctgccaagtttgaaggggacaatgggtctc
caggtcggagcttctaaacccgatgagaaccctacaattaaccttcagttcaagatccag
cagctggccatttctggactcaaagtgaaccgtctggatatgtacggagagaagtacaag
ccctttaagggcataaaatacatgaccaaagccggcaagttccaagtccgaacctga

KEGG   Rattus norvegicus (rat): 171126
Entry
171126            CDS       T01003                                 

Gene name
Ap3m1
Definition
(RefSeq) AP-3 complex subunit mu-1
  KO
K12398  AP-3 complex subunit mu
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    171126 (Ap3m1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    171126 (Ap3m1)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Others
   AP-3 complex
    171126 (Ap3m1)
 Endosome - Golgi transport
    171126 (Ap3m1)
SSDB
Motif
Pfam: Adap_comp_sub Clat_adaptor_s
Other DBs
NCBI-GeneID: 171126
NCBI-ProteinID: NP_598277
RGD: 620417
Ensembl: ENSRNOG00000011461
UniProt: Q6IRG9
Structure
PDB: 
4IKN

Position
15
AA seq 418 aa
MIHSLFLINCSGDIFLEKHWKSVVSQSVCDYFFEAQEKAADVENVPPVISTPHHYLISIY
RDKLFFVSVIQTEVPPLFVIEFLHRVADTFQDYFGECSEAAIKDNVVIVYELLEEMLDNG
FPLATESNILKELIKPPTILRSVVNSITGSSNVGDTLPTGQLSNIPWRRAGVKYTNNEAY
FDVVEEIDAIIDKSGSTVFAEIQGVIDACIKLSGMPDLSLSFMNPRLLDDVSFHPCIRFK
RWESERVLSFIPPDGNFRLISYRVSSQNLVAIPVYVKHNISFKENSSCGRFDITIGPKQN
MGKTIEGITVTVHMPKVVLNMNLTPTQGSYTFDPVTKVLAWDVGKITPQKLPSLKGLVNL
QSGAPKPEENPNLNIQFKIQQLAISGLKVNRLDMYGEKYKPFKGVKYITKAGKFQVRT
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgatccacagtctatttctcatcaactgttctggcgacatatttctagaaaaacactgg
aagagcgttgtaagccaatctgtgtgtgactatttctttgaagctcaggagaaagctgct
gatgttgaaaatgtaccacctgtcatttcaacacctcaccactacctcattagtatctac
cgggataagctcttctttgtgtctgtgatacagactgaagtgccacctctctttgtaatt
gagtttctgcatcgagttgctgacacttttcaggactactttggtgagtgttcagaggct
gcaattaaggataatgtggtcatagtgtatgagctcttggaagaaatgttagacaatgga
ttcccactggctaccgaatctaacattctgaaagaactgattaaaccaccaacaattcta
cgttctgtcgtcaattctattacaggcagtagtaatgttggggacacgctccccactggg
cagctgtccaacatcccgtggcgtcgagcaggtgtaaagtacaccaacaatgaagcctac
tttgatgtagtcgaagagatagatgcgattatagataaatcaggatctacagtctttgca
gaaattcaaggtgtcattgatgcttgcattaagctgtctggaatgcctgatctctctctc
tctttcatgaacccaaggcttctagatgatgtcagcttccacccatgcatccggttcaaa
cgctgggaatctgagagagttttgtcattcattcctcccgatggaaatttccgactcata
tcataccgcgtcagctcacaaaatctagtggcaatcccagtgtatgtgaaacataatatc
agctttaaggaaaacagctcttgtggtagatttgatataacaattggaccaaaacagaat
atgggaaaaacgattgaaggaatcacagtgactgttcacatgccaaaagttgtgctgaat
atgaacctgacaccaacacaaggcagctatacattcgatccagtcaccaaggtactagca
tgggatgtggggaaaattactccacaaaagctcccaagtcttaaaggactggtaaattta
cagtcaggagcacccaagccagaagagaacccaaacctcaacatacagttcaagatccag
cagcttgctatttcaggcttaaaagtgaaccgcttggacatgtatggtgagaagtataag
ccatttaaaggagtcaagtatatcacaaaggccggaaagttccaagtgaggacatga

KEGG   Rattus norvegicus (rat): 302290
Entry
302290            CDS       T01003                                 

Gene name
Ap3s1
Definition
(RefSeq) AP-3 complex subunit sigma-1
  KO
K12399  AP-3 complex subunit sigma
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    302290 (Ap3s1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    302290 (Ap3s1)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Others
   AP-3 complex
    302290 (Ap3s1)
 Endosome - Golgi transport
    302290 (Ap3s1)
SSDB
Motif
Pfam: Clat_adaptor_s
Other DBs
NCBI-GeneID: 302290
NCBI-ProteinID: NP_001100403
RGD: 1311115
Ensembl: ENSRNOG00000003829
UniProt: G3V9Y9
Position
18
AA seq 157 aa
MIKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLEGGLLIGGSD
NKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHVDKVHNIL
AEMVMGGMVLETNMNEIVTQIDAQNKLEKSESPRQDR
NT seq 474 nt   +upstreamnt  +downstreamnt
atgatcaaggccatcctcatcttcaacaaccacgggaagccgcggctctccaagttctac
cagccctatagtgaagatacgcaacagcaaatcatcagggagactttccatctggtgtct
aagcgagacgagaatgtttgtaatttcctagaaggaggattattaattggaggatctgac
aacaaactgatttacagacattatgcaacactatattttgtcttctgtgtggattcctca
gaaagtgaacttggcattttagatctaattcaagtatttgtggaaacattagacaaatgt
tttgaaaatgtctgtgagctggatttaatattccatgtagacaaggttcataatattctt
gcagaaatggtgatggggggaatggtattggagaccaacatgaatgagattgtcacacaa
attgatgcacaaaataaactggagaaatctgagtctcccagacaggacaggtag

KEGG   Rattus norvegicus (rat): 308777
Entry
308777            CDS       T01003                                 

Gene name
Ap3b2
Definition
(RefSeq) AP-3 complex subunit beta-2
  KO
K12397  AP-3 complex subunit beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    308777 (Ap3b2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    308777 (Ap3b2)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Others
   AP-3 complex
    308777 (Ap3b2)
 Endosome - Golgi transport
    308777 (Ap3b2)
SSDB
Motif
Pfam: Adaptin_N AP3B1_C Cnd1 HEAT_2 Alpha_adaptinC2
Other DBs
NCBI-GeneID: 308777
NCBI-ProteinID: NP_001101002
RGD: 1308950
Ensembl: ENSRNOG00000019249
Position
1
AA seq 1082 aa
MSAAPAYSEDKGGSAGPGEPEYGHDPASGGIFSSDYKRHDDLKEMLDTNKDSLKLEAMKR
IVAMIARGKNASDLFPAVVKNVACKNIEVKKLVYVYLVRYAEEQQDLALLSISTFQRGLK
DPNQLIRASALRVLSSIRVPIIVPIMMLAIKEAASDMSPYVRKTAAHAIPKLYSLDSDQK
DQLIEVIEKLLADKTTLVAGSVVMAFEEVCPERIDLIHKNYRKLCNLLIDVEEWGQVVII
SMLTRYARTQFLSPTQNESLLEENPEKAFYGSEEDEAKGPGSEEAATAALPARKPYVMDP
DHRLLLRNTKPLLQSRSAAVVMAVAQLYFHLAPKAEVGVIAKALVRLLRSHSEVQYVVLQ
NVATMSIKRRGMFEPYLKSFYIRSTDPTQIKILKLEVLTNLANETNIPTVLREFQTYIRS
MDKDFVAATIQAIGRCATNIGRVRDTCLNGLVQLLSNRDELVVAESVVVIKKLLQMQPAQ
HGEIIKHLAKLTDNIQVPMARASILWLIGEYCEHVPKIAPDVLRKMAKSFTAEEDIVKLQ
VINLAAKLYLTNSKQTKLLTQYVLSLAKYDQNYDIRDRARFTRQLIAPSEQGGALSRHAK
KLFLAPKPAPILESSFKDRDHFQLGSLSHLLNAKATGYQELPDWPEEAPDPSVRNVEVPE
WTKCSNREKRKEKEKPFYSDSEGESGPTESADSEPESESESGSKSSSESGSGESSSESDN
EDDDEEKGEGSESEQSEEEGEKKKKTKKKKASEGHREGSSSEEGSDSSSSSESEVTSESE
EEQVEPASWRKKTPPSSKSTPAAKEISLLDLEDFTSPSVQPVSPPMVVSTSLAADLEGLT
LTDSSLVPSLLSPVSSIGRQELLHRVAGEGLAVDYAFSRQPFSGDPHMVSLHIYFSNNSE
TPIKGLHVGTPKLPAGISIQEFPEIESLAPGESTTTVMGINFCDSTQAANFQLCTQTRQF
YVSIQPPVGELMAPVFMSENEFKKEQGKLTGMNEITEKLTLPDTCRSDHMVVQKVTATAN
LGRVPCGASDEYRFAGRTLTSGSLVLLTLDARGTGAAQLTVNSEKMVIGTMLVKDVIQAL
TQ
NT seq 3249 nt   +upstreamnt  +downstreamnt
atgtcggccgctcccgcctatagcgaagataagggcggctcagccggccccggggagccg
gaatatggccacgatccggcgagcggcggtatcttctcctcggactacaagcggcatgat
gacctgaaagagatgttggacaccaacaaggattccctcaagctggaggccatgaagagg
attgtggcaatgatcgcccgggggaagaatgcctcggacctgttccctgcagtggtgaag
aatgtggcctgtaagaacatagaggtgaagaagctggtctacgtgtacctggtccgatat
gctgaggaacagcaagacctagctctactgtccatctctactttccagcgtggcctaaag
gatcccaaccagctgatccgggccagcgcgcttcgtgttctctctagcatccgtgtgccc
atcatagtccccatcatgatgctagccatcaaggaagctgcctcggacatgtcaccctat
gttcggaaaacagctgctcatgccatccccaaactctacagtttggattctgatcagaag
gaccagctgatagaagtcattgagaagcttttggcagacaagaccacgctggtggcaggc
agtgtagtgatggcctttgaagaggtctgtccggaacgcatcgacctgattcacaaaaac
taccggaagctctgcaacctgctcatcgacgtggaggagtggggccaggtggtgatcatc
agcatgctcacgcgttatgcacgaacgcagttcctgagccctacgcagaacgagtctttg
ttggaggagaatcctgagaaggccttctatggctctgaggaggacgaggccaaaggccct
ggatcagaggaagcggccactgcggcgctgcctgctcggaagccctatgtaatggatcca
gatcaccggctgctgctgcggaacaccaagccgctactgcagagccgcagcgccgccgtg
gtcatggcggtggcacagctttacttccacctggcgcccaaggcagaggtgggcgtcatc
gccaaggctctcgttcgcctgctgcgcagccacagcgaggtgcagtacgtagtgctccag
aatgtggccaccatgtccatcaagcgcaggggaatgtttgaaccctacttgaagagcttc
tacattaggtccacggatcctacccagatcaagatcctgaagctggaagtgctgaccaac
ctggccaatgagaccaacatccccactgttctacgggaattccagacctacattcgcagc
atggacaaagactttgtggcggccacgatccaggccatcggacgatgtgcaacgaacata
ggccgagtccgtgacacctgcctcaatggcttggtgcagcttctgtccaaccgtgatgag
cttgtggttgctgagtcagtggtggtcattaagaagctgctgcaaatgcagccagcgcag
cacggcgagatcatcaaacacttggcaaaactcacagacaacatccaggtacccatggca
cgggccagcatcctctggctcattggagagtactgtgagcatgtgcccaagattgcccct
gatgttctgagaaaaatggccaagtccttcacagcagaggaggacatcgtgaagctgcag
gtcataaacctggcagccaagctgtacctgactaactcaaagcagaccaagctcttgacc
cagtatgtgctgagtctggccaagtacgaccaaaactatgatatccgggatcgagcccgc
ttcacccggcagctcatcgctccttcagagcagggtggtgccctcagccgccatgccaag
aagctcttcctggcccctaagccagcccctatcttggagtcatccttcaaagatcgggac
catttccaactgggctcactgtcccacctactcaacgcaaaggctacaggctaccaggag
ctcccagactggccagaggaagccccagatccatctgtgcgcaatgtggaggtacctgaa
tggaccaaatgctcaaatcgggagaagaggaaggagaaggaaaagcctttctattctgat
tctgagggggagtctggccccactgagtctgcagacagcgagcctgagtctgagagcgag
tcggggagtaagagcagcagtgagagtggctctggggagtctagcagtgagtcggacaat
gaagatgacgatgaagagaaaggcgaaggcagcgagagtgaacagagcgaggaggaaggt
gagaagaagaagaagacgaagaagaagaaggcgtcagagggacacagggaaggctcatcc
tcggaggagggcagtgactccagtagtagctctgagtctgaggtgacatcggagtcggag
gaagagcaggtagagcctgcctcctggaggaagaagacacctcccagcagcaaaagcacc
cctgcagccaaggagatttccctgcttgacctagaggacttcacctctcctagtgtccag
cctgtgtctcctcccatggttgtgtccaccagtttggctgctgacctggaaggtctgaca
cttacagactcgtctctggtgccttcgctgctgagtccagtgtccagcattgggaggcag
gagctgctgcaccgggtagctggagagggactggctgtggactatgccttcagccgccag
cctttctctggggatccccacatggtgtctctgcatatctacttctccaacaactccgag
actccgatcaaggggctgcatgtgggcactcccaagctgcctgctggcatcagcattcaa
gaatttcctgaaatcgagtccctggcacctggagaatccactactactgtgatgggcatt
aacttttgtgactcaacccaggcagccaacttccagctgtgcacccaaacccgacagttc
tatgtctccattcagccacctgtcggggagctgatggcccctgtatttatgagtgagaat
gagttcaagaaggaacagggaaagctgacaggaatgaatgagatcacagagaagcttaca
ctgccagacacctgtcggagtgatcacatggtggtgcagaaagtgactgccactgccaac
ctaggtcgtgttccttgtggggcatctgatgagtacaggtttgcagggaggacgctgact
agtgggagtctggtcctgctgactctggatgcccggggaactggagctgcccagctgact
gtcaacagtgagaagatggtgattggcaccatgctggtgaaggatgtgatacaggctctg
acacagtga

KEGG   Rattus norvegicus (rat): 309969
Entry
309969            CDS       T01003                                 

Gene name
Ap3b1
Definition
(RefSeq) AP-3 complex subunit beta-1
  KO
K12397  AP-3 complex subunit beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    309969 (Ap3b1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    309969 (Ap3b1)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Others
   AP-3 complex
    309969 (Ap3b1)
 Endosome - Golgi transport
    309969 (Ap3b1)
SSDB
Motif
Pfam: Adaptin_N AP3B1_C SEEEED Cnd1 BUD22
Other DBs
NCBI-GeneID: 309969
NCBI-ProteinID: NP_001101116
RGD: 1310256
Ensembl: ENSRNOG00000010624
UniProt: D3ZIF5
Position
2
AA seq 794 aa
MAVAQLYWHISPRSEAGVISKSLVRLLRSHREVQYIVLQNIATMSIQRKGMFEPYLKSFY
VRSTDPTMIKTLKLEILTNLANEANISTLLREFQTYVRSQDKQFAAATIQTIGRCATSIA
EVTDTCLNGLVCLLSNRDEIVVAESVVVIKKLLQMQPAQHGEIIKHMAKLLDSITVPVAR
ASILWLIGENCERVPKIAPDVLRKMAKSFTSEDDLVKLQILNLGAKLYLTNSKQTKLLTQ
YILNLGKYDQNYDIRDRTRFIRQLIVPNEKSGALSKYAKKIFLAQKPAPLLESPFKDRDH
FQLGTLSHTLNVKASGYLELSNWPEVAPDPSVRNVEVIESAKEWTPLGKTKKEKPEKKFY
SESEEEEEEEEEDEEDEEEDPSDSSSDSESGSGRESGDSGSSSEDSSEDSSSGQDSETGS
EAEAEHQRVAKTNSKTKRKSASEDREKKNGKSQASESSSEESSSTEESSSESESGSDSEP
APRKTAKAKERKPQQERHPPSKDVFLLDLDDFNPVSTPVALPTPALSPSLIADLEGLNLS
TSSSIINVSTPVFVPTKTHELLHRMRGKGLAAHYCFPRQPCIFGDKMVSVQITLTNTSDG
KIENIHVGGKKLAVGVQMHVFHPIESLEPEGSVTVSMGIDFCDSTQTASFQLCTKDDCFN
VNIQPPVGELLLPVAMSEKDFKKEQGMLTGMNETSATLIAAPQNFTPSMILQKVVNVANL
GAVPSSQDNIHRYERLKFQVLQERFAAKTVHSGSLMLVTVELKEGSTAQLIINTEKTVIG
SVLLRELKPVLSQG
NT seq 2385 nt   +upstreamnt  +downstreamnt
atggctgtcgctcagctgtactggcacatctcacccaggtcggaggctggtgtcatttct
aaatcgctggtgcgcctacttcgcagccatagggaggtgcagtatattgtattgcaaaat
atcgcaactatgtcaattcagagaaagggtatgtttgaaccttacctgaagagcttctat
gtccggtccactgatccaactatgatcaagactctgaagcttgaaatcttgacaaacttg
gcaaatgaagccaacatatcaactcttcttcgagaatttcagacctacgtgagaagccag
gacaaacagtttgcagcggccactattcagaccataggcagatgtgcaaccagcattgcc
gaggtcactgacacatgcctcaatggcctggtctgcctgctgtccaacagggatgaaata
gttgttgctgaaagtgtggttgttataaagaaattgttgcaaatgcagcctgcacagcat
ggtgagattattaagcacatggcgaagctgttggacagcatcactgtccctgtggctcga
gcaagcattctttggctgattggagaaaactgtgaacgcgttcctaaaattgctcctgat
gttttgagaaaaatggctaaaagtttcactagtgaagatgatctggtgaaactgcagatt
ttaaatcttggagcaaaattgtatttaactaattccaaacagacaaaattgcttacccag
tacatattaaatctcggcaagtatgatcagaactacgacatcagagaccgcacaagattt
attaggcagcttattgttccgaacgagaagagtggagctctaagtaaatatgccaaaaaa
atctttctagcacagaagcctgcaccactgctggagtctccctttaaagacagggatcat
ttccagcttggcaccttatctcatactctcaacgttaaagcgtccgggtacctggaatta
tctaattggccagaggtggcgcctgacccatcggttcgcaatgtagaagtaatagagtca
gcaaaagagtggaccccacttggaaaaacaaagaaagaaaaacctgagaagaaattttat
tcagaatctgaggaggaggaggaggaagaagaggaagatgaagaagatgaggaggaggat
ccctctgatagcagcagtgacagtgagagtgggtctggacgtgagagtggagactcaggc
agcagcagcgaggacagcagcgaggactcctccagtggacaagacagcgagaccggaagc
gaggcagaagcagaacaccagagggtggccaagacgaactccaaaaccaagaggaaaagt
gcctcagaagacagggagaagaaaaatggaaaatctcaggcctcggagtcgtccagtgag
gagtccagttccacagaagaaagttcttcagagtcagagtcaggctctgacagtgagcct
gcacccagaaaaacagctaaggcaaaagaaagaaaaccccagcaagaaagacatcctccc
tccaaagatgttttccttctcgatctggatgactttaacccagtatccaccccagttgcc
cttcctacaccagccctttctccaagcttgatagctgatcttgaaggtctaaacctgtca
acttcctcatccatcatcaacgtcagtacacctgtcttcgtgcccacaaaaacacatgag
ctgcttcaccgcatgcgtgggaaaggactggctgcccactactgcttcccaagacagcct
tgcatcttcggtgacaagatggtctctgtacagataaccctgaccaatacttccgatggg
aagatagagaacatccacgtaggcgggaagaagcttgctgtgggcgtgcagatgcacgtc
ttccatcccatagagtctctggagcctgagggatccgttactgtctcgatgggtattgac
ttctgtgattctacacagacggccagttttcagctgtgcaccaaggatgattgcttcaac
gtcaacatccagccacctgttggggagctgcttttacctgtggccatgtcagagaaagac
tttaagaaggagcaagggatgctcactgggatgaatgagacgtcggcaacgctcatcgcc
gctccgcagaacttcaccccctccatgatcctccagaaggttgtaaacgtcgccaacctc
ggtgcagtgccttccagccaagataacatacacagatatgagagattaaaattccaagtt
cttcaagaaaggtttgcagctaaaactgtgcacagtgggtcactgatgctagtcaccgtg
gaactgaaggaaggttccacagcccaacttatcatcaacaccgagaaaaccgtgattggc
tctgtgctgctgagggagctgaagcctgtcctgtcccaggggtaa

KEGG   Rattus norvegicus (rat): 314633
Entry
314633            CDS       T01003                                 

Gene name
Ap3d1
Definition
(RefSeq) AP-3 complex subunit delta-1
  KO
K12396  AP-3 complex subunit delta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    314633 (Ap3d1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    314633 (Ap3d1)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Others
   AP-3 complex
    314633 (Ap3d1)
 Endosome - Golgi transport
    314633 (Ap3d1)
SSDB
Motif
Pfam: Adaptin_N AP3D1 Cnd1 HEAT HEAT_2 RTP1_C1 RasGEF_N_2 Vac14_Fab1_bd
Other DBs
NCBI-GeneID: 314633
NCBI-ProteinID: NP_001094189
RGD: 1308659
Ensembl: ENSRNOG00000018977
UniProt: B5DFK6
Position
7
AA seq 1204 aa
MALKMVKGSIDRMFDKNLQDLVRGIRNHKEDEAKYISQCIDEIKQELKQDNIAVKANAVC
KLTYLQMLGYDISWAAFNIIEVMSASKFTFKRVGYLAASQCFHEGTDVIMLTTNQIRKDL
SSPSQYDTGVALTGLSCFVTPDLARDLANDIMTLMSHTKPYIRKKAVLIMYKVFLKYPES
LRPAFPRLKEKLEDPDPGVQSAAVNVICELARRNPKNYLSLAPLFFKLMTSSTNNWVLIK
IIKLFGALTPLEPRLGKKLIEPLTNLIHSTSAMSLLYECVNTVIAVLISLSSGMPNHSAS
IQLCVQKLRILIEDSDQNLKYLGLLAMSKILKTHPKSVQSHKDLILQCLDDKDESIRLRA
LDLLYGMVSKKNLMEIVKKLMTHVDKAEGTTYRDELLTKIIDICSQSNYQHITNFEWYIS
ILVELTRLEGTRHGHLIAAQMLDVAIRVKAIRKFAVSQMSSLLDSAHLVASSTQRNGICE
VLYAAAWICGEFSEHLQGPQQTLEAMLRPKVTTLPGHIQAVYVQNVVKLYASILQQKEQA
ADTEGAQEVTQLLVERLPQFVQSADLEVQERASCILQLVKHVQKLQAKGVPVAEEVSALF
AGELNPVAPKAQKKVPVPEGLDLDAWINEPPSDSESEDEKPKAIFHEEEPRHTRRRQPEE
DEEELARRREARKQEQANNPFYIKSSPSPQKRYQDAPGVEHIPVVQIDLSVPLKVPGMPM
SDQYVKLEEQRRHRQRLEKDKKRKKKEKGKRRHSSLPTESDEDIAPAQRVDIITEEMPEN
ALPSDEDDKDPNDPYRALDIDLDKPLADSEKLPVQKHRNAETVKSPEKEGVPGVEKKSKK
PKKKEKKPKEREREKKDKKGEDLDFWLSTTPPPAAAPVPAPSTEGLAASIVTPPKGECEV
LKGEEPQDEEDHMDHDQERKSSRHKKKKHRKEKEERPRDKKKAKRKQVVQLENGAPAEEE
EEEEEPIPPMSSYCLLAENPYIKVTYDVQASLQKDSQVTVSIILENQSSSFLKNMELNVL
DSLNTKMARPEGSSVHDGVPVPFQLPPGVSNEAQFVFTIQSIVMAQKLKGTLSFIAKDDE
GATHEKLDFRLHFSCSSYLITTPCYSDAFAKLLESGDLSMNSIKVDGISISFQNLLAKIC
FYHHFSVVERVDSCASMYSRSIQGHHVCLLVKKGESSVSVDGKCSDATLLSSLLEEMKTT
LSQC
NT seq 3615 nt   +upstreamnt  +downstreamnt
atggccctcaagatggtcaagggcagtatcgaccgcatgttcgacaagaacctgcaggat
ctggtccgcggcatccgcaaccacaaggaggacgaggccaagtacatctcccagtgcatt
gacgagatcaagcaggaactcaagcaggacaacattgctgtgaaggccaacgctgtctgc
aagctcacctacttacagatgctcgggtacgacatcagctgggctgccttcaacatcatt
gaagtcatgagtgcctccaagttcacattcaagcgtgtcggctaccttgcagcctctcag
tgcttccatgaaggtactgacgtcatcatgctgaccactaaccagatccgaaaggacctg
agcagccctagccagtacgacactggagtggcactgactggtctgtcctgttttgtcacc
ccagatcttgccagagacctggcaaatgacatcatgaccctgatgtctcacacgaagcca
tacatcaggaagaaggcagtgctgatcatgtacaaagtgttcctcaagtaccctgagtca
ctgcgtcctgcctttccccggcttaaggagaagctggaggacccagacccaggggtgcag
tctgcagctgtcaatgtcatctgtgagctagcgcgccgaaaccctaaaaactacctgtct
ctggctccactgtttttcaagctcatgacatcctctaccaacaactgggtcctcatcaag
atcatcaaactgttcggtgccctgactcccctggagcccaggctgggcaagaagctgatc
gagcctctcaccaacctcattcacagcacctctgccatgtccctgctgtacgagtgtgtg
aacaccgtgattgctgtgctcatctcactgtcttccgggatgcccaaccacagcgccagc
atccagctatgcgttcagaagttgaggatactgatagaggactccgaccagaacttaaag
tacctggggctgctggccatgtctaaaatcctgaagacacatcccaagtctgtgcaatcc
cacaaggacctgatcctgcagtgcctggatgacaaagacgagtccatccgcctgcgtgcc
cttgacctgctctatggaatggtgtccaaaaagaacctgatggaaattgtgaagaagctt
atgacccacgtggacaaggccgagggcaccacctatcgtgacgagctgctcaccaagatc
attgacatctgtagccagtccaactaccagcacatcaccaacttcgagtggtacataagc
atccttgtggagctgacaagactggagggcacccggcatggtcacctcattgctgcacag
atgctggacgtggccattcgggtcaaggccattcgaaaatttgctgtgtcccagatgtct
tcgctgcttgatagtgcccacctggtagccagcagcacccaacgcaacggcatctgtgag
gtgctctatgctgctgcctggatctgcggggagttctcggagcacctacaggggccccag
caaaccctggaggccatgctgcggcccaaggtcaccacactgcccggccacatccaggct
gtgtatgtgcagaacgtggtaaagctgtacgcgtccatcctgcagcagaaggagcaggct
gccgacactgagggggcacaggaggtcacccagctactagtggagcggctgccacagttt
gtgcagagcgccgacctggaggtgcaggagcgggcgtcttgcatcctgcagctggtcaag
catgtacagaagctgcaagcaaaaggcgtgccggtggccgaggaagtgagcgccttgttt
gctggggaactgaaccctgtggcccccaaggcccagaagaaggtcccagttcctgaaggc
ctagacctggatgcctggatcaatgagccaccttcagacagtgagtctgaggatgagaaa
cccaaggccatctttcatgaagaggagccaaggcacacccggcgccggcagcctgaggag
gatgaggaggagctggcccggcggcgagaggcccggaagcaggagcaagccaacaatccc
ttctacatcaagagctccccatccccgcagaagcgataccaagacgcaccaggcgtggag
cacattcctgtggtacagatcgacctctccgtgcctctgaaagttccaggtatgcccatg
tcagaccagtatgtgaagctggaggaacagcggcgacaccggcagcggctggagaaggac
aagaaaaggaagaagaaggagaagggcaagcgtcgccacagttccctgcccacggagagt
gatgaggacatcgcccccgcccagcgtgtggacatcatcactgaggagatgcctgagaat
gctctgcctagtgatgaggatgacaaagaccccaatgacccctacagggcactggacatt
gacctagataagcccttggccgacagtgagaagctgcctgtccagaaacatagaaacgcg
gagacagtgaagtccccagagaaggagggtgtgcctggggtggagaagaagagcaagaag
cccaagaagaaggagaagaagcccaaagagagagaaagggagaagaaggacaagaagggt
gaggacttagacttctggctgtccaccaccccgccacctgctgctgcccccgtccctgcc
ccatctacggaaggacttgctgcgagcattgtcaccccccctaagggtgagtgtgaggtt
ctcaaaggggaagagccccaggacgaggaggaccacatggatcatgaccaagaaaggaaa
tcatcccggcacaagaagaagaaacacaggaaggagaaggaggagaggccacgagacaaa
aagaaagccaagaggaagcaggtggtgcagctagagaatggtgcgccagcagaggaggaa
gaggaggaggaggaacctatcccgcccatgtccagttactgccttctggctgagaatccg
tacattaaagtgacatatgacgtccaagccagcttacagaaggacagccaagtgactgtg
tctatcatcctggagaatcagagcagcagcttcctgaagaacatggaactcaacgtgcta
gactcactcaacaccaagatggccaggccagagggctcatcagtgcatgatggtgtgcct
gtgcctttccagctgccccccggcgtctccaatgaggcccagtttgtgttcaccattcag
agcatcgtcatggcccagaagctcaaaggcacgctgtccttcattgccaaggatgatgaa
ggagccacccatgagaagttggacttccggctgcatttcagctgtagctcgtacctgatc
accaccccctgctacagcgatgcctttgccaagttgctggagtcaggagacctgagcatg
aactccatcaaagttgatggcattagtatatctttccagaatcttctggcaaagatctgc
ttctaccaccatttttccgttgtggagcgagtagactcctgcgcctccatgtacagccgc
tctatccagggccatcacgtctgcctgctggtgaagaagggtgagagctccgtgtcagtg
gacgggaagtgcagcgatgccacgctgctcagcagcctgctggaggaaatgaagaccacg
ctgtctcagtgctga

KEGG   Rattus norvegicus (rat): 683402
Entry
683402            CDS       T01003                                 

Gene name
Ap3s2
Definition
(RefSeq) AP-3 complex subunit sigma-2
  KO
K12399  AP-3 complex subunit sigma
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    683402 (Ap3s2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    683402 (Ap3s2)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Others
   AP-3 complex
    683402 (Ap3s2)
 Endosome - Golgi transport
    683402 (Ap3s2)
SSDB
Motif
Pfam: Clat_adaptor_s
Other DBs
NCBI-GeneID: 683402
NCBI-ProteinID: NP_001108511
RGD: 1586888
Ensembl: ENSRNOG00000043141
UniProt: B0BNM6
Position
1
AA seq 193 aa
MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSD
YKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYIL
QEVVMGGMVLETNMNEIVAQIEAQNRLEKSEGGLSAAPARAVSAVKNINLPEIPRNINIG
DLNIKVPNLSQFV
NT seq 582 nt   +upstreamnt  +downstreamnt
atgattcaggcgattctggttttcaacaaccatgggaaaccgcggctggtccgcttctac
cagcgttttccagaagaaattcaacagcagattgttcgagagaccttccacctggtcctc
aagcgagatgacaacatctgtaacttcttagaaggtggaagtttgattggtggctctgac
tacaaactgatttaccggcactatgctaccctctacttcgtgttttgtgtggattcatca
gagagtgaacttgggatcttggacctcatccaggtttttgtggagactctggataagtgt
tttgaaaatgtctgtgagttggacttgatcttccatatggataaggtgcactacatcctc
caggaggtggtgatgggtgggatggtgttggaaacaaacatgaatgagatcgtggctcaa
attgaagctcaaaacaggctggagaagtcggagggtggcctttcagcagcccctgcaagg
gccgtgtccgctgtgaagaacatcaaccttcccgagatccccaggaacatcaacatcggc
gatctcaacatcaaagttcccaacctgtctcagtttgtgtga

DBGET integrated database retrieval system