KEGG   Rattus norvegicus (rat): 140669
Entry
140669            CDS       T01003                                 

Gene name
Abcb6, MTABC3
Definition
(RefSeq) ATP-binding cassette, subfamily B (MDR/TAP), member 6
  KO
K05661  ATP-binding cassette, subfamily B (MDR/TAP), member 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    140669 (Abcb6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    140669 (Abcb6)
Transporters [BR:rno02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB6, 7 subgroups
    140669 (Abcb6)
SSDB
Motif
Pfam: MTABC_N ABC_tran ABC_membrane SMC_N AAA_16 RsgA_GTPase AAA_29 AAA_22 AAA AAA_21 AAA_24 MMR_HSR1 AAA_30 AAA_23
Other DBs
NCBI-GeneID: 140669
NCBI-ProteinID: NP_542149
RGD: 71077
Ensembl: ENSRNOG00000018697
UniProt: O70595
Position
9q33
AA seq 836 aa
MVTVGNYCEAEGPAGPAWTQNGLSPCFFYTLVPSTLMTLGVLALVLVLPCRRREVPAGTE
ELSWAAGPRVAPYALQLSLAILQMALPLASLAGRVGTARGVRLPGYLLLASVLESLASAC
GLWLLVVERSQARQSLAMGVWMKFRHSLGLLLLWTVTFAAENLVLVSWNSPQWWWSRADL
GQQVQFGLWVLRYMTSGGLFILGLWAPGLRPQSYTLHVNEEDQDGGRNQGRSTDPRSTWR
DLGRKLRLLSGYLWPRGSPSLQLTVLLCMGLMGLDRALNVLVPIFYRDIVNLLTSKAPWS
SLAWTVTTYVFLKFLQGGGTGSTGFVSNLRTFLWIRVQQFTSRGVELRLFSHLHELSLRW
HLGRRTGEVLRIVDRGTSSVTGLLSYLVFNIIPTLADIIIGIIYFSMFFNAWFGLIVFLC
MSLYLILTIMVTEWRAKFRRDMNTQENATRARAVDSLLNFETVKYYNAEGYELERYREAI
LKFQGLEWKSTASLVLLNQTQNMVIGFGLLAGSLLCAYFVSERRLQVGDFVLFGTYITQL
YMPLNWFGTYYRMIQTNFIDMENMFDLLKEETEVKDVPGAGPLRFHKGRVEFENVHFSYA
DGRETLQDVSFTVMPGQTVALVGPSGAGKSTILRLLFRFYDISSGCIRIDGQDISQVTQI
SLRSHIGVVPQDTVLFNDTIANNIRYGRVTAGDSEIQAAAQAAGIHDAILSFPEGYETQV
GERGLKLSGGEKQRVAIARTILKAPDIILLDEATSALDTSNERAIQASLAKVCTNRTTIV
VAHRLSTVVNADQILVIKDGCIIERGRHEALLSRGGVYAEMWQLQQQGQETVPEDS
NT seq 2511 nt   +upstreamnt  +downstreamnt
atggtgactgtgggcaactactgcgaggccgaagggccggcggggccggcatggactcag
aatggcttgagtccctgcttcttctacactctagtgccctcgacactcatgactttgggg
gtactggccttggtgctggttcttccctgcaggcgtcgggaggtgcctgctggcacagag
gagctatcttgggcggctggccctcgggtcgctccctatgcgctgcagctgtctctggcg
atacttcagatggcactgcccctggccagtctggctggccgagtgggcactgctcggggg
gtccgcctgccaggttacctactgctggcttctgtgctggagagtctagccagtgcctgt
ggcttgtggctgctcgtggtggaacggagccaggcacggcagagtctggcaatgggcgtc
tggatgaagttcaggcatagcttgggtcttctgctcctctggactgtgacatttgcagcc
gagaacttggtcctggtatcttggaacagcccacagtggtggtggtccagggcagatctg
ggccagcaggttcaatttggcctatgggtcctgcgttatatgacctctggagggctattt
atcctggggctctgggcccctggacttcgcccccagtcttataccctacatgttaatgaa
gaagaccaagatggaggaaggaaccagggccgctcaacagacccacgatccacttggaga
gacctcggcaggaagcttcgactgctgagtggctacttgtggcctcgggggagtccatct
ctgcagctgactgtgctcctatgcatgggcctcatggggttggaccgagcactcaatgtg
ttggtccccatcttctatagggacattgtgaacttactgacttcgaaggctccttggagc
tccctggcctggaccgttaccacctatgtcttcctcaagttcctgcaggggggtggcact
ggcagtacaggttttgtgagcaaccttcgaaccttcctgtggatccgggtgcagcagttc
acgtcccgaggtgtggaactccgtctcttctctcatctgcatgaactctcactgcgctgg
cacctgggccgtcggactggggaggtgcttcggattgtggaccggggaacatccagtgtc
acaggactgctcagctacctggtgttcaacatcatccccaccctggccgacatcatcatt
ggcatcatctacttcagcatgttcttcaatgcctggtttggcctcattgtgttcctgtgc
atgagtctttacctcatcctcactattatggtcactgagtggagagccaagtttcgccgt
gatatgaacacacaggaaaatgccacccgggcacgagcagtagactctctgctaaacttt
gagacggtgaaatactacaatgcggagggttatgagttagaacgctatcgagaggccatc
ctcaagtttcagggtttggagtggaagtcaacggcttcactggttttactgaatcagacc
cagaacatggtgattggatttgggctccttgctggctccttgctttgtgcatacttcgtc
agcgagcgacggctacaggttggggactttgtgctttttggcacttatatcacccaactg
tacatgcctctcaactggttcggcacctactacagaatgatccagactaacttcattgac
atggagaacatgtttgacttgttgaaagaggaaacagaggtgaaggacgtccctggagca
gggccccttcgttttcataagggccgggttgagtttgaaaatgtgcacttcagctacgct
gatgggcgggagaccttacaagatgtgtccttcactgtgatgcctggacagacggtggct
ctggtaggcccatctggggcaggaaagagcacaattttacgcctgctgtttcgcttctat
gacatcagctctggctgcatccgaatagatggacaggacatttcacaggtaacccagatc
tctctccggtctcacattggagttgtgccccaggacactgtcctcttcaacgacaccatt
gccaacaatatccgctatggccgtgttacagctggggacagtgagatacaggctgctgct
caggctgcgggcatccatgatgccatcttgtctttccctgaagggtatgagacacaggtt
ggggagcggggtctgaagctgagtggtggcgagaagcagcgagtggccattgcccgcacc
atccttaaggctcctgacatcattctgctggatgaggcaacatcagcactggatacatct
aatgagagagccatccaggcctctctggccaaagtctgcaccaaccgcaccaccatcgta
gtagcacacaggctctcaactgtggtcaatgctgaccagattcttgtcatcaaggatggc
tgcatcatagagagaggaaggcacgaagccctgctatcccgaggtggcgtgtatgctgag
atgtggcagctgcagcagcaaggacaagaaactgtccctgaagactcttaa

DBGET integrated database retrieval system