KEGG   Rattus norvegicus (rat): 140670Help
Entry
140670            CDS       T01003                                 

Gene name
Ap2b1
Definition
(RefSeq) adaptor-related protein complex 2, beta 1 subunit
  KO
K11825  AP-2 complex subunit beta-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04721  Synaptic vesicle cycle
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno05016  Huntington's disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    140670 (Ap2b1)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    140670 (Ap2b1)
  Nervous system
   04721 Synaptic vesicle cycle
    140670 (Ap2b1)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    140670 (Ap2b1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    140670 (Ap2b1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adaptin_N Cnd1 B2-adapt-app_C HEAT_2 HEAT Alpha_adaptinC2 Arm Cnd3 RTP1_C1 CLASP_N TIP120 Arm_2 Sec7_N
Motif
Other DBs
NCBI-GeneID: 140670
NCBI-ProteinID: NP_542150
RGD: 71048
Ensembl: ENSRNOG00000061543
Vega: OTTRNOG00000000479
UniProt: P62944 Q3ZB97
Structure
PDB: 

Position
10q26
AA seq 951 aa AA seqDB search
MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQT
DNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITE
YLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANA
VAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSI
CERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQY
VALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKE
YATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRK
YPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQV
QLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEV
VLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGST
DAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGL
DSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGG
YVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIP
STPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLF
VEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDM
LYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgactgactccaagtacttcacaaccaataagaagggagaaatctttgaattaaaagct
gaactcaacaatgaaaagaaagaaaagaggaaggaggctgtgaagaaagtgattgctgct
atgaccgtggggaaggatgtgagctctctcttcccagatgtggtgaactgtatgcagact
gacaacctggaactaaagaagcttgtgtacctctatctgatgaactatgccaagagtcag
ccagacatggccatcatggctgtcaacagctttgtgaaggattgtgaagaccccaatcct
ttgattcgagccttggcagttagaaccatgggatgcatccgggtggacaagattacagag
tatctctgtgaacccctccgcaagtgcttgaaggatgaagacccctatgttcggaaaaca
gcagcagtatgcgtggcaaaactccatgatatcaatgcccagatggtggaagatcaggga
tttctggattctctgcgggatctcatagcagattcaaacccaatggtggtggctaatgct
gtagcagcattgtctgagatcagtgagtctcacccaaacagcaacttacttgatctgaac
cctcagaatatcaataagctgctcacagccctgaatgagtgcactgagtggggccagatt
ttcatcttggactgcctgtctaattacaaccctaaagatgaccgggaagctcagagcatc
tgtgagcgagtgacgcctcggctctctcatgccaattctgcagtggtgctttcagcagta
aaagttctgatgaagtttctagagttgttacccaaggactctgactactacaatatgctg
ctaaagaagctagcgcctccacttgtcactttgctctctggggagccagaagtgcagtat
gttgccctgaggaacatcaacctaattgtccagaaaaggcctgaaatcttgaagcaggaa
atcaaggtcttctttgtgaagtacaatgatcctatctatgttaaactagagaagttagac
atcatgattcgtcttgcatcccaagccaacattgctcaggttctggcagaactgaaggaa
tatgccactgaagttgatgtggactttgttcgcaaagctgtgagggccattggacggtgt
gccatcaaagtggagcaatcagcagaacgctgtgtgagcacactgcttgatctaatccag
accaaagtaaattatgtggtccaagaggcaattgttgtcatcagggacatcttccgaaaa
taccccaacaagtatgagagcattatcgccacgctgtgtgagaacttggactccctggat
gaacccgatgcccgagcggctatgatttggattgtaggagagtatgctgaaagaatcgat
aatgccgatgagttactagagagcttcctggaaggttttcatgatgaaagcacccaggtg
cagctcacgttgcttaccgccatagtgaaactgtttctcaagaagccatcagaaacacag
gagctggtccaacaggtcttgagcttggccacacaggattctgataatcctgaccttcga
gatcggggttatatttattggcgccttctttcaactgaccctgtgacagccaaagaagta
gtgttgtctgagaagccattgatctctgaggaaacagacctcattgaacctaccctcctg
gatgagctcatctgccacattggttctttggcctccgtgtaccataaacctccgaatgct
tttgtggaagggagccatggcattcatcgcaaacacttgccaattcaccatgggagcact
gatgcaggtgatagccctgttggcaccaccactgcaaccaacctggaacagcctcaggtc
atcccctctcaaggtgaccttctgggggatcttttaaatcttgacctgggtcccccagtg
aatgtcccgcaagtgtcctccatgcagatgggagcagtggatcttttaggaggaggactg
gatagcctgcttggcagtgaccttggcgggggcattggaggaagtccggcagtaggacag
tccttcatcccgtcatcagtgcctgcaaccttcgctccttcacctactcctgctgtggtc
agcagtggtctgaatgacctgtttgagctttccactgggataggcatggcacctggcgga
tatgtggctcctaaggcagtctggctacctgctgtaaaggctaaaggcttggagatttcg
gggacgtttactcaccgccaagggcacatctatatggaaatgaacttcaccaacaaagct
ctgcagcacatgacggattttgccatccagtttaacaagaatagcttcggtgtcatcccg
agcactcccttggccatacatactccgctgatgccaaaccagagcattgatgtgtctctg
cctctcaacaccttgggcccagtcatgaagatggagcctctgaataacttgcaggtggct
gttaaaaacaatattgatgtcttctacttcagctgcctcatcccactcaatgtgcttttt
gtagaagatggcaaaatggaacgccaggtcttccttgcgacgtggaaggatattcccaat
gaaaatgagctccaatttcagattaaggagtgtcatttaaacgctgacacagtttccagc
aagttgcaaaacaacaatgtttacactatcgccaagaggaatgtggaggggcaggacatg
ctgtaccagtccctgaagctcactaatggcatttggattttggcagagctgcggatccag
ccaggaaaccccaattatacgctgtcgctgaagtgtagagcccctgaagtctctcagtac
atctatcaggtctacgacagcattttgaaaaactaa

DBGET integrated database retrieval system