KEGG   Rattus norvegicus (rat): 140673
Entry
140673            CDS       T01003                                 

Gene name
Napa, alpha-SNAP
Definition
(RefSeq) NSF attachment protein alpha
  KO
K15296  alpha-soluble NSF attachment protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    140673 (Napa)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    140673 (Napa)
Membrane trafficking [BR:rno04131]
 SNARE
  SNARE associated proteins
   Others
    140673 (Napa)
SSDB
Motif
Pfam: SNAP TPR_12 TPR_7 Spatacsin_C RIG-I_C
Other DBs
NCBI-GeneID: 140673
NCBI-ProteinID: NP_542152
RGD: 620855
Ensembl: ENSRNOG00000001494
UniProt: P54921
Structure
PDB: 

Position
1q21
AA seq 295 aa
MDTSGKQAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIYARAANMFKMAKNWSA
AGNAFCQAAQLHLQLQSKHDAATCFVDAGNAFKKADPQEAINCLMRAIEIYTDMGRFTIA
AKHHISIAEIYETELVDVEKAIAHYEQSADYYKGEESNSSANKCLLKVAGYAAQLEQYQK
AIDIYEQVGTSAMDSPLLKYSAKDYFFKAALCHFCIDMLNAKLAVQKYEELFPAFSDSRE
CKLMKKLLEAHEEQNVDSYTESVKEYDSISRLDQWLTTMLLRIKKTIQGDEEDLR
NT seq 888 nt   +upstreamnt  +downstreamnt
atggacacctccgggaagcaggctgaggctatggcgctgctggctgaagcggagcgcaag
gtgaagaactcgcagtccttcttctccggcctctttggaggttcatccaaaatagaggaa
gcatgcgagatctatgccagagctgcgaacatgttcaagatggccaagaactggagcgct
gctgggaacgctttctgccaggctgcccaactgcacctacagctccagagcaagcacgat
gcagccacctgctttgtggacgccggcaacgctttcaagaaagctgacccccaagaggcc
attaactgtctgatgagagcaattgagatctatacagacatgggcagattcacaatcgca
gccaagcaccacatctccattgctgagatctatgagacagaactggtggatgtagagaag
gccattgcccactacgagcaatctgcagactactacaaaggagaagagtccaacagctca
gccaacaagtgtctgctgaaggtggctggctacgccgcacagctggagcagtaccagaag
gctatcgacatctatgagcaggtggggaccagcgccatggacagtcccctcctcaagtac
agcgccaaagactacttcttcaaggcggccctttgccacttctgcatcgacatgctgaac
gccaagcttgctgttcagaagtatgaggagctgttccctgccttctcggattcccgggaa
tgcaagctgatgaaaaagctgctggaagcccatgaggaacagaatgtggacagctacaca
gagtcggtgaaggaatatgactccatctccagactggaccagtggcttaccaccatgctt
ctacgaatcaagaagaccattcagggtgatgaggaagacctgcgctag

DBGET integrated database retrieval system