KEGG   Rattus norvegicus (rat): 140693
Entry
140693            CDS       T01003                                 

Gene name
Plcd4
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno04020  Calcium signaling pathway
rno04070  Phosphatidylinositol signaling system
rno04919  Thyroid hormone signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
Module
rno_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    140693 (Plcd4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    140693 (Plcd4)
   04070 Phosphatidylinositol signaling system
    140693 (Plcd4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    140693 (Plcd4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    140693 (Plcd4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    140693 (Plcd4)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     140693 (Plcd4)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    140693 (Plcd4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    140693 (Plcd4)
SSDB
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like EF-hand_10 C2 PH EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_5 PH_12 GDPD EF-hand_8
Other DBs
NCBI-GeneID: 140693
NCBI-ProteinID: NP_542419
RGD: 621025
Ensembl: ENSRNOG00000016361
UniProt: Q62711
Position
9
AA seq 772 aa
MASQIQKLLTTNQDLLLMQKGTMMRKVRTKSWKKLRYFRLQDDGMTVWHGRHLESISKPT
FSISDVERIRKGQDSELLRYLVEEFPLEQGFTIVFNGRRPNLDLVANSVEEAQTWMRGLQ
LLVDLVARMNYQEQLDQMLREWFQQADRNQDSRMSFREAQRLLLLMNVEMDEEYAFSLFQ
EADVSQSNTLDSEEFVQFYKALTKRTEIEELFENFSSDKQKLTLLEFVDFLREEQKESDH
SSDLALKLIDRYEPSENGRLLRVLSKDGFLSYLCSADGNIFNPDCLPIYQDMTQPLSHYY
INSSHNTYLLGDQFCGQSSVEGYIRALKRGCRCVEVDTWDGPDGEPVVYHGRTLTSRILF
KDVLATLAQYAFQSSDYPLILSLDNHCTWEQQKTMAHHLIAILGEQLLSTTLEEQLIDIM
PSPEQLRGKILVKGKKLRTIEVVESDKEEEELEKDEGSDLDPASAELDMQSQPESQEQAS
GNKSKNKKKFLLQSSTTILCPDLSALVVYLRTAPFCSFTHSKENYHIYDISSFSESKAKN
LIREAGNEFVQHNARQLCRVYPSGLRTDSSNYNPQEHWNVGCQMVAMNMQTAGSAMDICD
GLFRQNGGSGYVLKPEFLRDTQSSFNPMKPVSLYKAQILVVQVISGQRLPKVDKTKETTV
VDPLVRVELYGVPEDTKQQETSYVENNGINPYWGETFYFQIQVPELAMLRFVVKDYSRTS
RNNFIGQYTLPWTCMKHGYRHVSLLSKDGTSLHPASIFVYTCMQEDLDMDEP
NT seq 2319 nt   +upstreamnt  +downstreamnt
atggcatctcagattcaaaagctactgaccactaatcaggacctgctgctgatgcaaaaa
ggaacgatgatgcgcaaggtgaggaccaaaagctggaagaagctaagatacttcagactt
caggatgacggcatgacggtctggcatgggcggcaccttgaaagcatatccaagcccact
ttttcaatctctgatgtggagaggatccgtaagggccaggattctgagctgttgcgctat
ctggtggaagagttccccctggagcaaggcttcaccattgtctttaatgggcgccgcccc
aacctggacctagtggccaacagtgttgaagaggcccagacttggatgcgaggactccag
ctgttggtggatctcgtcgccagaatgaactaccaggagcagctggatcaaatgttgaga
gaatggttccaacaagcagacagaaaccaggacagccggatgagtttcagagaagctcaa
cggctgctgcttctgatgaatgtggaaatggatgaagaatatgccttcagtctttttcag
gaagcagatgtttcccaatctaatactctggattcagaagaatttgtacagttctataag
gccctgactaagcgcactgagattgaagaactatttgagaacttttcatctgacaaacag
aagctgaccttgctggaatttgtagatttccttagagaggaacagaaagaaagcgaccat
tcctctgaccttgctctgaaactcattgaccgctatgagccttctgagaatggcagattg
ctacgtgtgctgagcaaggatggcttcctcagctacctctgctcagcggatggaaacatc
ttcaaccccgactgcctccctatctatcaggatatgactcagcctctgagtcactactac
atcaactcctctcacaacacctacctactgggtgaccagttttgtggccagagcagcgtt
gaaggatacatacgggccttgaaacgggggtgccgctgtgtggaggtggatacatgggac
ggacctgacggagagcccgttgtttatcatgggcgtacactgacctctcgtatcctgttc
aaagatgttttggcaacattagcacaatatgccttccagtcgtcagactacccactcatc
ttatctctggataaccactgcacttgggaacagcagaagaccatggcacaccatctgatt
gcgatcctgggagagcagctgctgagtaccaccctagaggaacaactgattgatataatg
ccctcgccagagcagcttcgggggaagatcttggtaaaaggaaagaagttgagaacaatt
gaggttgttgagtctgacaaggaggaagaagagctggagaaagatgaggggtcagatctg
gacccagcctccgctgagcttgacatgcagtctcagcccgagtcccaggagcaggcctct
gggaacaagagcaagaacaagaagaagtttcttctccagagttccacaaccatcctatgc
ccagacctatctgccctggttgtctacttgaggactgctcccttctgcagcttcactcac
tccaaagaaaactaccacatctacgacatttcatccttttctgagtccaaggccaagaac
ctcatcagggaggcaggcaatgagtttgtacagcacaatgccagacagctatgccgtgta
taccccagtggtctgaggacagattcatcgaactataacccccaggaacactggaatgtt
ggctgccaaatggtggccatgaacatgcagactgcaggaagtgcaatggacatctgtgat
gggctcttccgccagaatgggggctctggctatgtgctgaagccagaattcctgagagat
acccagagttccttcaatcccatgaagcccgttagtctttataaagcccagatccttgta
gtccaggtgatcagtggtcaaagactccccaaagtggacaaaaccaaagagacaaccgtt
gtggatccactggtgagagtagagctctatggtgttcctgaagacacaaagcagcaagag
accagctatgtggagaacaatggtattaatccatactggggggagacattctatttccag
atccaggtgcctgaacttgctatgctgcgttttgtggtaaaggattatagcaggacatcc
cgaaataactttataggccaatacaccctgccttggacctgcatgaaacatggctaccga
catgtatccttgctctccaaagacggcactagcctccatccagcctccatctttgtgtac
acctgcatgcaagaagacctggatatggatgagccctga

KEGG   Rattus norvegicus (rat): 24655
Entry
24655             CDS       T01003                                 

Gene name
Plcd1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno04020  Calcium signaling pathway
rno04070  Phosphatidylinositol signaling system
rno04919  Thyroid hormone signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
Module
rno_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    24655 (Plcd1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    24655 (Plcd1)
   04070 Phosphatidylinositol signaling system
    24655 (Plcd1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    24655 (Plcd1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    24655 (Plcd1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    24655 (Plcd1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     24655 (Plcd1)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    24655 (Plcd1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    24655 (Plcd1)
SSDB
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like EF-hand_10 C2 PH_12 PH EF-hand_6 EF-hand_1 EF-hand_7 Tail_P2_I REV1_C TEP1_N
Other DBs
NCBI-GeneID: 24655
NCBI-ProteinID: NP_058731
RGD: 3346
Ensembl: ENSRNOG00000032238
UniProt: P10688
Structure
PDB: 

Position
8
AA seq 756 aa
MDSGRDFLTLHGLQDDPDLQALLKGSQLLKVKSSSWRRERFYKLQEDCKTIWQESRKVMR
SPESQLFSIEDIQEVRMGHRTEGLEKFARDIPEDRCFSIVFKDQRNTLDLIAPSPADAQH
WVQGLRKIIHHSGSMDQRQKLQHWIHSCLRKADKNKDNKMNFKELKDFLKELNIQVDDGY
ARKIFRECDHSQTDSLEDEEIETFYKMLTQRAEIDRAFEEAAGSAETLSVERLVTFLQHQ
QREEEAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSADGNAFSLAHRRVYQDMDQ
PLSHYLVSSSHNTYLLEDQLTGPSSTEAYIRALCKGCRCLELDCWDGPNQEPIIYHGYTF
TSKILFCDVLRAIRDYAFKASPYPVILSLENHCSLEQQRVMARHLRAILGPMLLDQPLDG
VTSSLPSPEQLKGKILLKGKKLGGLLPAGGENGSEATDVSDEDEAAEMEDEAVRSQVQHK
PKEDKLKLVPELSDMIIYCKSVHFGGFSSPGTSGQAFYEMASFSESRALRLLQESGNGFV
RHNVSCLSRIYPAGWRTDSSNYSPVEMWNGGCQIVALNFQTPGPEMDVYLGCFQDNGGCG
YVLKPAFLRDPNTTFNSRALTQGPWWAPKRLRVRIISGQQLPKVNKNKNSIVDPKVIVEI
HGVGRDTASRQTAVITNNGFNPRWDMEFEFEVTVPDLALVRFMVEDYDSSSKNDFIGQST
IPWNSLKQGYRHVHLLSKNGDQHPSATLFVKISIQD
NT seq 2271 nt   +upstreamnt  +downstreamnt
atggactcgggtagggacttcctgaccctgcacgggctccaggatgacccggaccttcag
gcccttctgaagggcagccagcttctgaaggtgaagtccagctcgtggcgtagggaacgc
ttctacaagctacaggaggactgcaagaccatctggcaggaatctcgaaaggtcatgagg
tccccggagtcgcagctgttctccatcgaggacattcaggaggtacggatgggacaccgc
acagaaggcctggagaagtttgcccgagacatccccgaggatcgatgcttctccattgtc
ttcaaggaccagcgcaacaccctagacctcattgccccatcaccagctgacgctcagcac
tgggtgcagggcctgcgcaagatcatccaccactccggctccatggaccagcggcagaag
ctgcagcactggattcactcctgcttgcgaaaggctgataaaaacaaggacaacaagatg
aacttcaaggagctgaaggacttcctgaaggagctcaacatccaggtggatgacggctac
gccaggaagatcttcagggaatgtgaccactcccagacagactcgctggaggatgaggag
attgagaccttctacaagatgctgacccagcgcgcagagatcgaccgtgcttttgaggag
gccgcaggatccgcggagaccctgtcggtggagaggctagtgacgtttctgcagcaccag
cagcgggaggaggaggcagggccagccttggccctctctctcattgagcgctacgagccc
agtgagactgccaaggcccagcggcagatgaccaaggatggcttcctcatgtacttgctg
tcggctgacggtaacgccttcagcctggcacaccgccgtgtctaccaggacatggaccag
ccactgagtcactacttagtgtcttcttcccacaacacctacctgctggaagaccagctc
acagggcccagcagcacggaggcctacatccgggctctgtgcaaaggctgccggtgcttg
gagctcgactgctgggatggtcccaaccaggaacccatcatctaccacggctacactttt
acctctaagatacttttctgtgacgtgctcagggccatcagggactatgccttcaaggca
tccccctacccagtcatcctgtccctggagaaccactgtagcctggagcaacaacgagtc
atggcccgtcacctgagggctatcctggggcccatgctgttggaccagccactggatggg
gttacctcgagcctgccttcacctgagcaactgaagggcaagatcctgttgaaagggaag
aagctgggagggctgctgcctgctggaggggagaatgggtccgaagccactgacgtgtct
gacgaggatgaggctgctgaaatggaggacgaggctgtgcgcagccaagtgcaacacaag
cccaaggaggataaactaaagctggtgccggagctctccgacatgatcatttactgcaag
agcgtccactttggtggcttctccagtcctggcacctctgggcaggcattctatgagatg
gcttccttttctgagagccgtgccctccggttgctgcaagaatcaggaaatggttttgtc
cgtcataacgtgagctgtctgagcaggatctacccggctgggtggagaacagattcctcc
aactacagtcctgtggagatgtggaacgggggctgccagattgtggctctgaacttccaa
acccctgggccagaaatggatgtttaccttggctgcttccaggacaatggaggctgtggg
tatgtgctgaaacccgcctttctgagagaccccaacaccaccttcaactcacgtgccctg
actcaggggccctggtgggctccgaagaggctccgtgtccggatcatctctggacagcag
ctgccaaaggtcaataagaataagaattctatcgtggaccccaaggtgatcgtggagatc
catggcgtgggccgggacacggctagccgtcagacagcagttattaccaataatggtttc
aacccacggtgggacatggagtttgagtttgaggtaacagtgcctgaccttgccctcgta
cgcttcatggtagaggattatgattcctcttctaagaacgactttattggccagagtact
atcccctggaacagcctcaagcaggggtaccgccatgtccacctcttgtctaagaatgga
gaccagcatccatcagccacactttttgtgaagatctccatccaggactaa

KEGG   Rattus norvegicus (rat): 287745
Entry
287745            CDS       T01003                                 

Gene name
Plcd3
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno04020  Calcium signaling pathway
rno04070  Phosphatidylinositol signaling system
rno04919  Thyroid hormone signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
Module
rno_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    287745 (Plcd3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    287745 (Plcd3)
   04070 Phosphatidylinositol signaling system
    287745 (Plcd3)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    287745 (Plcd3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    287745 (Plcd3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    287745 (Plcd3)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     287745 (Plcd3)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    287745 (Plcd3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    287745 (Plcd3)
SSDB
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_10 EF-hand_like C2 EF-hand_6 EF-hand_7 PH SPARC_Ca_bdg FANC_SAP S_100
Other DBs
NCBI-GeneID: 287745
NCBI-ProteinID: NP_001099315
RGD: 1310903
Ensembl: ENSRNOG00000003033
UniProt: D4A978
Position
10
AA seq 788 aa
MLCGGWRRSRRSPEEPRVSAQVAAPLAFLPSPASSDSSTKRPGLRALKKMGLTEDEDVQA
MLRGSKLLKIRSRTWHKERLYRLQEDGLSVWFQRRIPRAASQHIFFVQHIEAVREGHQSE
GLRRFGGAFAPARCLTIAFKGRRKNLDLAAPTAEEAQRWVRGLAKLRARLDAMSQRERLD
HAHTWIHSYLHRADSDQDSKMSFKEIKSLLRMVNVDMNDMYAYRLFKECDHSNNERLEGA
EIEAFLRRLLKRPELEEIFRRYSGEDRVLSASELLEFLEDQGEDGATLACAQKLIQTYEL
NETAKQHELMTLDGFMMYLLSPEGAALNVAHTCVFQDMGQPLAHYFISSSHNTYLTDSQI
GGTSSTEAYIRAFTQGCRCVELDCWEGPGGEPVIYHGHTLTSKILFRDVIQAVRDHAFTL
SPYPVILSLENHCGLEQQIVMARHLRNILGDMLVTQALDSQNPEELPSPEQLKCRVLVKG
KKLPAARNEDGRILSDREDEDEDEEEAEEALETAEQRKRAKQISPELSALVVYCCATRLR
TLEPSPGPPQPCKIGSLSERKARKFTREAGTSFVRHNTQQLTRVYPLGLRMTSANYNPQE
MWNSGCQLVALNFQTPGYEMDLNTGRFLINGQCGYVLKPAYLRQLNTTFDPECPGPPRTT
LTVQVLTAQQLPKLNVEKPNSIVDPLVRVEIYGVPEDCAHKETDYVLNNGFNPCWEQTLQ
FQLRAPELVLVRFVVEDYDTTSPNDFVGQFTLPLNSLKQGYRHIHLLSKDGASLSPATLF
VHIRIENS
NT seq 2367 nt   +upstreamnt  +downstreamnt
atgctgtgcggtggctggagaaggagccgccgctcgccggaggaaccccgggtgtccgcc
caggtcgcagcgcccctcgcgttcttgccctcgcccgcgtcatccgatagcagcaccaaa
aggcccgggctacgggcactgaagaagatgggcctgacggaggatgaggatgtccaagcc
atgctgcggggctccaagctcctcaagatccgctcacgcacgtggcacaaggagcggctg
taccggctgcaggaggatggcctgagcgtgtggtttcagcggcgcatcccccgcgcagct
tcgcagcacatcttcttcgtgcagcacatcgaggctgtccgggaaggccatcagtcggag
ggcctgcggcggttcgggggcgcctttgcgcctgcgcgctgcctcaccatcgccttcaag
ggccgccgcaagaacctggacctggcagcgcccactgcggaggaagcgcagcgctgggtg
cgagggctggccaagctgagggcgcgcctggatgccatgagccagcgggagcggctagac
cacgcacacacctggatccattcctatctgcaccgggccgactccgaccaagacagcaag
atgagcttcaaggagatcaagagcctgctgaggatggtcaacgtggacatgaatgacatg
tacgcctaccgcctcttcaaggagtgtgaccattctaacaacgagcgtctggaaggggct
gagatcgaggctttcctccggaggctgcttaaacggcccgagctggaggagatcttccgc
cgatactccggcgaggaccgggtactgagtgcctctgagctgctggagttcctggaagac
cagggcgaggacggtgccaccctggcctgtgcccagaagcttatccagacgtatgagctc
aacgagacagccaagcagcacgagctgatgacgctggatggcttcatgatgtatctgttg
tcgcctgagggggctgcgctgaacgtggcccacacgtgtgtgttccaggacatgggtcag
cccctggcccactactttatctcgtcctctcataatacttacctgactgactctcagatc
ggagggaccagcagcaccgaggcctacatcagggcctttacccagggatgccgctgtgtg
gaacttgactgctgggaggggccgggaggggagcccgtcatctaccatgggcataccctt
acttccaagattctctttcgagatgtgatccaagctgtgcgtgaccacgctttcacgctg
tccccatatcctgttatcctgtcccttgagaatcactgcgggttggaacagcagattgtc
atggctcgccaccttcggaacatcctgggagacatgctggtgacacaggccctggactcc
cagaaccccgaggagctgccgtctcctgagcagctcaaatgccgggtcttggtgaagggg
aagaagctgccagctgctcggaatgaggatggtcgaattctgtcagacagggaggatgaa
gatgaagatgaagaggaggcagaagaggctttggagactgcagagcagaggaagcgagcc
aaacagatctccccagagctctcagcgctggttgtgtattgctgtgctacccgcctgcgg
accctggagcctagtcctggtccacctcagccttgcaagattggctccctcagcgagcgc
aaggccaggaagttcaccagggaggcaggaaccagttttgtcaggcacaacactcagcaa
ctgacccgagtgtacccactggggctgcggatgacctcggccaactataacccccaggag
atgtggaactcgggctgtcaactggtggctctgaactttcagactcctggctatgagatg
gacctcaacacggggcgcttcctcataaatgggcagtgcggctatgtcctgaaacccgcc
tacctcaggcaactcaacaccacctttgaccccgagtgccctggaccccccagaactact
ctgacagtccaggtgttaacggcccagcagctgcccaagctgaatgtagagaagcccaac
tccattgtggatcctctggtgcgtgtggagatctacggggtgcctgaagactgtgcgcac
aaggagacggactatgtgctcaataatggcttcaacccctgctgggagcagactctgcag
ttccaactgcgggccccagagctggttctggtgaggtttgtggtagaagactatgatacc
acctcccccaatgattttgtgggacagtttacactgcccctcaacagcctgaagcaaggg
taccgccacatccacttgctgtccaaggatggagcctcgctctctccagccacactcttc
gttcacatccgcattgagaactcttga

DBGET integrated database retrieval system