KEGG   Rattus norvegicus (rat): 140694
Entry
140694            CDS       T01003                                 

Symbol
Dnm1
Name
(RefSeq) dynamin-1
  KO
K01528  dynamin 1/3 [EC:3.6.5.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04072  Phospholipase D signaling pathway
rno04144  Endocytosis
rno04721  Synaptic vesicle cycle
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    140694 (Dnm1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    140694 (Dnm1)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    140694 (Dnm1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    140694 (Dnm1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    140694 (Dnm1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    140694 (Dnm1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    140694 (Dnm1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.5  dynamin GTPase
     140694 (Dnm1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Dynamin
    140694 (Dnm1)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    140694 (Dnm1)
   RhoA-dependent endocytosis
    140694 (Dnm1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   140694 (Dnm1)
SSDB
Motif
Pfam: Dynamin_M Dynamin_N GED PH MMR_HSR1
Other DBs
NCBI-GeneID: 140694
NCBI-ProteinID: NP_542420
RGD: 71096
Ensembl: ENSRNOG00000033835
UniProt: P21575
Structure
PDB: 
2AKA 3ZVR

Position
3
AA seq 851 aa
MGNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRG
SGIVTRRPLVLQLVNSTTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPI
NLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSD
LANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQK
DIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKL
QSQLLSIEKEVDEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGA
RINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDLAFEATVKKQVQKL
KEPSIKCVDMVVSELTSTIRKCSEKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLID
IELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQDEILVIRKGWLTINNIGIMKGGSKE
YWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDY
RQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVE
TIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAE
QAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRSPTSSPT
PQRRAPAVPPARPGSRGPAPGPPPAGSALGGAPPVPSRPGASPDPFGPPPQVPSRPNRAP
PGVPRITISDP
NT seq 2556 nt   +upstreamnt  +downstreamnt
atgggcaaccgcggcatggaagacctcatcccgctggttaaccggttacaggacgccttc
tctgccatcggccagaacgcggacctcgacttgccgcagatcgccgtggtaggcggccag
agcgccggcaagagctcggtgctggagaatttcgtgggcagggacttcttgccccgagga
tccggcatcgtcacccggcgtcccctggtcctgcagctggttaattctaccacagaatat
gccgagttcctgcactgcaaggggaagaaattcaccgacttcgaggaggtgcgcctggag
atcgaggctgagaccgaccgagtcactggcaccaacaagggcatttcgcctgtgcccatc
aacctgcgtgtctactcaccccatgtgctcaacctgactctagtggacctgccaggaatg
accaaggtcccagttggggaccaacctcctgacatcgagttccagatccgggacatgctt
atgcagtttgtcactaaggagaactgccttatcctggctgtgtcccctgccaactcggac
ctggccaactctgatgccctcaagatcgccaaggaggtggacccccagggtcagcgcacc
attggggtcatcaccaagttggacctgatggacgagggcacagatgctcgggatgtgctg
gagaacaagctgctcccattgcgcagaggctacattggcgtggtgaaccggagccagaag
gacatagatggcaagaaggatatcacagccgccttggctgccgagcgcaaattcttcctc
tcccacccatcctaccgccacttggctgaccgcatgggcacaccctacctgcagaaggtc
ctcaaccagcaactgaccaaccacatccgggacacgctgccgggacttcggaacaaactg
cagagccagctgctgtccattgagaaggaggtggacgagtacaagaacttccgaccggat
gacccagcgcgcaagaccaaggccctgctgcagatggtccagcagtttgcagtggacttc
gagaagcgcattgagggttctggagaccagatcgacacttatgaactgtcaggtggagcc
cgcattaaccggatcttccacgaacgcttcccttttgagctggttaagatggagtttgat
gagaaggaactgcgaagggagatcagctacgctatcaagaacattcatggcatcaggaca
ggcctcttcactcctgacctcgcttttgaagccacagtgaaaaagcaggtgcagaagctc
aaagagcccagtatcaagtgtgtggacatggtagtcagtgagctcacgtccaccatcaga
aagtgtagtgaaaagctccagcaatacccccgtctgcgggaggaaatggaacggattgtg
accacccacatccgagaacgtgagggccgcaccaaggagcaggtcatgcttctcatcgac
attgagttggcttacatgaataccaaccatgaagacttcataggctttgccaatgctcag
cagagaagcaaccagatgaacaagaagaagacttcagggaaccaggatgagattctggtc
attcgaaaggggtggctgaccatcaacaacatcggcatcatgaagggaggctccaaggag
tactggtttgtgttgactgctgagaatctgtcctggtacaaggacgatgaggagaaagag
aagaagtacatgctgtctgtggataatctgaagctgcgtgatgtggagaagggcttcatg
tcaagcaagcatatttttgccctcttcaacactgagcagaggaatgtctacaaggattac
cggcagctggaactggcctgtgagacacaggaggaggtggacagttggaaggcttccttt
ctgagggctggcgtgtaccctgagcgtgttggggacaaggagaaagccagtgagactgag
gagaacggctctgacagcttcatgcactccatggaccctcagctggagcgccaggtggag
accatccggaacctggtagactcgtacatggccattgtcaacaagactgtacgggatctc
atgcccaagaccatcatgcacctcatgatcaacaataccaaggagtttatcttctctgag
ctgctggccaacctgtactcttgcggggaccagaacacgctgatggaagaatcggccgaa
caggctcagcggcgcgacgagatgctgcgtatgtaccacgcactgaaggaggcgctcagc
attatcggcgacatcaacacgaccaccgtcagcacgcccatgcccccgcccgtggacgac
tcctggctgcaggtgcagagcgtaccggccggacgcaggtcgcccacgtccagccccacg
ccgcagcgccgagcccccgccgtgcccccagcccggcccgggtcgcggggccctgctcct
gggcctccgcctgctggatccgccctggggggggctccccccgtgccctccaggccgggg
gcttcccctgacccctttggcccccctccccaggtgccctcgcgccccaaccgcgccccg
cctggggtccccagaatcactatcagtgacccctga

DBGET integrated database retrieval system