KEGG   Rattus norvegicus (rat): 140724Help
Entry
140724            CDS       T01003                                 

Gene name
Cacng3
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit gamma 3
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04260  Cardiac muscle contraction
rno04261  Adrenergic signaling in cardiomyocytes
rno04921  Oxytocin signaling pathway
rno05410  Hypertrophic cardiomyopathy (HCM)
rno05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
rno05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    140724 (Cacng3)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    140724 (Cacng3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    140724 (Cacng3)
   04261 Adrenergic signaling in cardiomyocytes
    140724 (Cacng3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    140724 (Cacng3)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    140724 (Cacng3)
   05414 Dilated cardiomyopathy (DCM)
    140724 (Cacng3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    140724 (Cacng3)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   140724 (Cacng3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 ABC2_membrane_2
Motif
Other DBs
NCBI-GeneID: 140724
NCBI-ProteinID: NP_542422
RGD: 628803
Ensembl: ENSRNOG00000012362
UniProt: Q8VHX0
Position
1q36
AA seq 315 aa AA seqDB search
MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTH
SGLWRTCCLEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGL
CVAASEFHRSRHSVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFY
FGAFSFIIAEIVGVVAVHIYIEKHQQLRARSHSELLKKSTFARLPPYRYRFRRRSSSRST
EPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKLTMGTLLNSDRDHAFLQFHNSTPKEFK
ESLHNNPANRRTTPV
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgtgtgacagaggtatccagatgttgatcaccactgtaggagccttcgcagct
ttcagtttaatgaccattgcggtgggcacggactactggctatattccagaggtgtgtgc
aggactaaatctacaagtgacaatgaaaccagcaggaaaaatgaagaagtaatgacccac
tccgggttgtggaggacctgctgcttagaaggagctttccgaggcgtgtgcaagaaaatc
gatcacttcccagaagatgcagactatgaacaggatacagcagaatatcttctccgggct
gtgagggcctccagtgtcttccccatcctcagcgtcactctgctgtttttcgggggactc
tgtgtagctgccagcgagttccaccgcagtaggcacagtgttatcctcagcgccggcatc
ttcttcgtctctgcagggctaagcaacatcatcggcatcatagtttatatctcagccaat
gctggagaccctgggcagagggactctaaaaagagctactcctacggctggtccttttat
tttggagccttctctttcatcatcgcggaaattgtgggtgtggtcgccgtgcacatctat
attgagaagcatcagcagctgcgcgccagatcccattcagagctcctgaagaagtctaca
tttgcgcgcctaccgccctacaggtatagattccgaagacggtcaagttctcgctccact
gaacctagatcccgagacctgtctcccatcagcaaaggcttccacaccatcccttccact
gacatctccatgttcaccctgtcccgggacccctctaagcttaccatggggacccttctc
aactctgaccgggaccatgcttttctacagttccacaactccacacccaaagagttcaaa
gagtcgttgcataacaatccggccaacagacgcaccacgcccgtctga

DBGET integrated database retrieval system