KEGG   Rattus norvegicus (rat): 140866
Entry
140866            CDS       T01003                                 

Gene name
Dgka, Dagk1
Definition
(RefSeq) diacylglycerol kinase, alpha
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00561  Glycerolipid metabolism
rno00564  Glycerophospholipid metabolism
rno01100  Metabolic pathways
rno04070  Phosphatidylinositol signaling system
rno04072  Phospholipase D signaling pathway
rno05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    140866 (Dgka)
   00564 Glycerophospholipid metabolism
    140866 (Dgka)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    140866 (Dgka)
   04072 Phospholipase D signaling pathway
    140866 (Dgka)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    140866 (Dgka)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     140866 (Dgka)
SSDB
Motif
Pfam: DAGK_acc DAG_kinase_N DAGK_cat C1_1 EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 C1_2 Sororin
Other DBs
NCBI-GeneID: 140866
NCBI-ProteinID: NP_542965
RGD: 70904
Ensembl: ENSRNOG00000022943
UniProt: P51556
Position
7q11
AA seq 727 aa
MAKDKGLISPEDFAQLQKYIDYSTKSVSDVLKVFEMNKYCQGDEIGYLGFEQFLKMYLEV
EEVPHHLCWTLFWSFHSSQDLDEETESKANVICLSDVYCYFTLLEGGSPEDKLEFTFKLY
DMDRNGILDSTEVEKIILQMMRVAEYLDWDVSELRPILQEMMKEMDRDGSGCVSLAEWVR
AGATTVPLLVLLGIDMTMKDDGHHIWRPKRFSRPVYCNLCELSIGLGKQGLSCNLCKYIV
HDHCAMKAQPCEVSTYAKSRKDIGVQPHVWVRGGCHSGRCDRCQKKIRTYHSLTGLHCVW
CHLEIHDDCLQAVGPECDCGLLRDHILPPCSIYPRVLVSGQECKQKTTDVTSLCTPEAFR
IEPVSNTHPLLVFINPKSGGKQGQSVLWKFQYILNPRQVFNLKDGPEPGLRFFKDVPQFR
VLVCGGDGTVGWILETIDKANFPIVPPVAVLPLGTGNDLARCLRWGRGYEGENLRKILKD
IEISKVVYLDRWLLEVIPQQNGEKSDPVPSQIINNYFSIGVDASIAHRFHLMREKYPEKF
NSRMKNKLWYLEFATSESIFSTCKKLEESVTVEICGKLLDLSDLSLEGIAVLNIPSMHGG
SNLWGDTKRPHGDTCGINQALGSVAKIITDPDILKTCVPDMSDKRLEVVGIEGVIEMGQI
YTRLKSAGHRLAKCSEITFQTTKTLPMQVDGEPWMQAPCTIKITHKNQMPMLMGPAPSSS
NFFGFWS
NT seq 2184 nt   +upstreamnt  +downstreamnt
atggccaaagacaagggcctcatcagcccagaagactttgcccagctgcaaaagtacata
gactactccaccaaaagtgtcagcgatgtgctgaaggtctttgagatgaacaaatattgc
caaggagatgagattgggtacctgggatttgaacagttcctgaaaatgtatctggaagtg
gaggaggttccccatcacctatgctggactctgttttggtccttccatagcagtcaagac
ttggatgaggagactgagtcaaaagccaatgtgatctgtctcagtgacgtctactgctac
ttcaccctcctggaaggcggcagtccggaagacaagctagagttcaccttcaagctgtac
gacatggacagaaatgggatcctagacagcacagaagtagaaaaaatcatcctgcaaatg
atgagagtggctgaatatctggactgggatgtgtctgagctgagaccgatccttcaggag
atgatgaaagagatggaccgggatggcagtggctgtgtctccctagctgagtgggtccgg
gctggggctaccactgtgcccctgcttgtccttctggggatagacatgactatgaaagat
gatggacaccatatatggagacccaagagattctccagaccggtctactgcaacctgtgc
gagttgagcattggcctcggcaaacaaggcctgagctgtaacctctgtaagtacattgtt
catgaccactgtgccatgaaggcccagccttgtgaagtcagcacctatgccaagtctcgg
aaagacattggtgtccagccacacgtatgggttcgaggaggctgtcattctggacgctgc
gaccgctgtcagaaaaagatccggacctaccacagcctaacgggactgcactgcgtgtgg
tgccacctggagatccacgatgactgtctgcaggctgttggtcccgagtgtgactgtgga
ctgctccgtgatcatatcctgcctccgtgttctatctaccccagggtcctggtatctgga
caggagtgcaaacagaagaccacagatgttacgagcctgtgcacccctgaggcttttcgg
attgaacctgtttctaacacccacccccttctggtcttcatcaatcctaagagcggaggc
aagcaggggcagagcgtgctttggaagttccagtacattctgaaccctcggcaggtgttt
aacctgaaggatggtccggagccagggctcaggtttttcaaagacgttcctcagttccgg
gtgttggtgtgtggtggagacggcaccgtaggctggattctagagaccattgacaaagcc
aactttcccattgtgcctccagtcgctgtgttgcccctgggcactggaaatgacctggct
cggtgcctaagatggggaagaggttatgaaggtgagaacttgagaaagattctcaaggat
atagagataagtaaggtggtatatctcgatcgatggctcctggaagtgataccccaacaa
aacggagaaaagagtgatccagttccctctcaaatcatcaataactacttctccattggt
gtggatgcttccattgctcaccggttccatctcatgagagagaaataccctgagaagttc
aatagcagaatgaagaacaagctttggtacttggagtttgccacatcggagtccatcttc
tcaacgtgcaaaaagctggaagagtcagtgaccgtcgagatatgtgggaagctgctggat
ctgagtgacctgtccctcgaaggcattgcggtattgaatatcccgagcatgcatggtggc
tccaatctctggggtgacaccaagagacctcacggggatacgtgtgggatcaaccaggca
ctgggcagtgtggccaaaataatcacagaccccgatattctcaaaacctgtgtgccagac
atgagtgacaagcggctggaagtcgtaggaatagagggtgtgattgagatgggtcagatc
tataccaggctcaagagtgctggacaccggctggccaagtgctccgagatcacgttccag
accacaaaaaccctccctatgcaagttgatggagaaccctggatgcaagcaccctgtaca
atcaagatcacccataagaaccagatgcctatgctaatgggtccggctcccagttcctcc
aatttctttggcttttggagctga

DBGET integrated database retrieval system