KEGG   Rattus norvegicus (rat): 140868
Entry
140868            CDS       T01003                                 

Gene name
Fabp5, C-FABP, DA11, E-FABP
Definition
(RefSeq) fatty acid binding protein 5, epidermal
  KO
K08754  fatty acid-binding protein 5, epidermal
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    140868 (Fabp5)
SSDB
Motif
Pfam: Lipocalin DUF1967
Other DBs
NCBI-GeneID: 140868
NCBI-ProteinID: NP_665885
RGD: 70997
Ensembl: ENSRNOG00000049075
UniProt: P55053
Position
2q23
AA seq 135 aa
MASLKDLEGKWRLVESHGFEDYMKELGVGLALRKMGAMAKPDCIITLDNNNLTVKTESTV
KTTVFSCTLGEKFDETTADGRKTETVCTFTDGALVQHQKWEGKESTITRKLKDGKMVVEC
VMNNAICTRVYEKVQ
NT seq 408 nt   +upstreamnt  +downstreamnt
atggccagccttaaggacctggaagggaagtggcgtctggtggaaagccacgggtttgag
gactacatgaaggaactaggagtagggctggctcttaggaagatgggtgccatggccaaa
ccagactgcatcattaccctcgacaacaacaacctcaccgtcaaaactgagagcacagtg
aagacgaccgtgttttcttgcaccttgggagagaagtttgatgaaaccacagctgatggc
aggaaaactgagacggtctgcaccttcacagacggtgccctggtccagcaccagaagtgg
gaagggaaagaaagcacgataacgagaaaactgaaggacgggaagatggtggtggagtgc
gtcatgaacaatgccatctgtactcgggtctatgagaaggtacaatga

DBGET integrated database retrieval system