KEGG   Rattus norvegicus (rat): 140908
Entry
140908            CDS       T01003                                 

Gene name
Cdk5
Definition
(RefSeq) cyclin-dependent kinase 5
  KO
K02090  cyclin-dependent kinase 5 [EC:2.7.11.22]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05030  Cocaine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    140908 (Cdk5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    140908 (Cdk5)
   05022 Pathways of neurodegeneration - multiple diseases
    140908 (Cdk5)
  09165 Substance dependence
   05030 Cocaine addiction
    140908 (Cdk5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    140908 (Cdk5)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    140908 (Cdk5)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     140908 (Cdk5)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  CDK family
   140908 (Cdk5)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    140908 (Cdk5)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Haspin_kinase Seadorna_VP7 Kinase-like APH
Other DBs
NCBI-GeneID: 140908
NCBI-ProteinID: NP_543161
RGD: 70514
Ensembl: ENSRNOG00000008017
UniProt: Q03114
Position
4q11
AA seq 292 aa
MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKH
KNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSLLFQLLKGLGFCHSR
NVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYS
TSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPAMTKLPDYKPYP
MYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
NT seq 879 nt   +upstreamnt  +downstreamnt
atgcagaaatacgagaaactggagaagattggggaaggcacctacggaactgtgttcaag
gccaaaaaccgggaaacccatgagattgtggctctgaagcgagtcaggctggacgatgac
gatgagggtgtgccaagttcagccctccgggagatctgtctactcaaagaactgaagcac
aaaaacattgtcaggcttcatgatgtcctgcatagtgacaagaagctcacattggtgttt
gagttctgtgatcaggacctgaagaaatattttgacagctgcaatggtgacctggaccct
gagattgtgaagtcactcctcttccagctgctgaaaggcctgggattctgtcacagccgt
aacgtgctgcacagggacctgaagccccagaatctgctcattaacaggaatggggaactg
aaattggctgattttggcctggcccgagcctttggtatcccagtccgctgctactctgct
gaggtggtcacgctgtggtaccgcccaccggatgtcctctttggggccaagctgtactcc
acgtccatcgacatgtggtcagccggctgcatctttgcagagctggccaatgcagggcga
cctctcttccccggcaatgatgtggatgaccagctgaagaggatctttcgactgctaggg
acaccgactgaggaacagtggcctgccatgaccaaactgccagactataagccctaccca
atgtacccagctacaacatccttggtgaatgtcgtgcccaaactcaatgccacggggaga
gacctgttgcagaacctgttgaagtgtaacccagtgcagcgcatctcggcagaggaggcc
ttgcagcacccctatttctctgacttctgtcccccgtag

DBGET integrated database retrieval system