KEGG   Rattus norvegicus (rat): 140908Help
Entry
140908            CDS       T01003                                 

Gene name
Cdk5
Definition
(RefSeq) cyclin-dependent kinase 5
  KO
K02090  cyclin-dependent kinase 5 [EC:2.7.11.22]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
rno05010  Alzheimer disease
rno05030  Cocaine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    140908 (Cdk5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    140908 (Cdk5)
  09165 Substance dependence
   05030 Cocaine addiction
    140908 (Cdk5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    140908 (Cdk5)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    140908 (Cdk5)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     140908 (Cdk5)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  CDK family
   140908 (Cdk5)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    140908 (Cdk5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like Seadorna_VP7 APH
Motif
Other DBs
NCBI-GeneID: 140908
NCBI-ProteinID: NP_543161
RGD: 70514
Ensembl: ENSRNOG00000008017
UniProt: Q03114
Position
4q11
AA seq 292 aa AA seqDB search
MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKH
KNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSLLFQLLKGLGFCHSR
NVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYS
TSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPAMTKLPDYKPYP
MYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaatacgagaaactggagaagattggggaaggcacctacggaactgtgttcaag
gccaaaaaccgggaaacccatgagattgtggctctgaagcgagtcaggctggacgatgac
gatgagggtgtgccaagttcagccctccgggagatctgtctactcaaagaactgaagcac
aaaaacattgtcaggcttcatgatgtcctgcatagtgacaagaagctcacattggtgttt
gagttctgtgatcaggacctgaagaaatattttgacagctgcaatggtgacctggaccct
gagattgtgaagtcactcctcttccagctgctgaaaggcctgggattctgtcacagccgt
aacgtgctgcacagggacctgaagccccagaatctgctcattaacaggaatggggaactg
aaattggctgattttggcctggcccgagcctttggtatcccagtccgctgctactctgct
gaggtggtcacgctgtggtaccgcccaccggatgtcctctttggggccaagctgtactcc
acgtccatcgacatgtggtcagccggctgcatctttgcagagctggccaatgcagggcga
cctctcttccccggcaatgatgtggatgaccagctgaagaggatctttcgactgctaggg
acaccgactgaggaacagtggcctgccatgaccaaactgccagactataagccctaccca
atgtacccagctacaacatccttggtgaatgtcgtgcccaaactcaatgccacggggaga
gacctgttgcagaacctgttgaagtgtaacccagtgcagcgcatctcggcagaggaggcc
ttgcagcacccctatttctctgacttctgtcccccgtag

DBGET integrated database retrieval system