KEGG   Rattus norvegicus (rat): 140910Help
Entry
140910            CDS       T01003                                 

Gene name
Msmo1, Sc4mol
Definition
(RefSeq) methylsterol monooxygenase 1
  KO
K07750  methylsterol monooxygenase [EC:1.14.18.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00100  Steroid biosynthesis
rno01100  Metabolic pathways
Module
rno_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    140910 (Msmo1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.9  4alpha-methylsterol monooxygenase
     140910 (Msmo1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_hydroxylase DUF4886
Motif
Other DBs
NCBI-GeneID: 140910
NCBI-ProteinID: NP_543162
RGD: 620281
Ensembl: ENSRNOG00000032297
UniProt: O35532
Position
16p13
AA seq 293 aa AA seqDB search
MAMNKSVGLFSSASLAVDYVDSLLPENPLQEPFKNAWVYMLDNYTKFQIATWGSLIVHET
IYFLFSLPGFLFQFIPFMRKYKIQKDKPETFEGQWKCLKGILFNHFFIQLPLICGTYYFT
EFFNIPYDWERMPRWYFTLARCLGCAVIEDTWHYFLHRLLHHKRIYKYIHKVHHEFQAPF
GIEAEYAHPLETLILGTGFFIGIVLLCDHVILLWAWVTMRLLETIDVHSGYDIPLNPLNY
IPFYTGARHHDFHHMNFIGNYASTFTWWDRIFGTDVQYHAYTEKMKKLGKKSE
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggccatgaacaaaagtgttggcctcttcagctccgcatccctggctgtggactacgta
gattccctgctgcctgagaatcctctgcaggaaccctttaagaatgcttgggtctacatg
ttggacaactatacaaagttccagatcgcaacctggggctccctgatcgttcatgagacg
atctatttcctgttctctttacctggctttctattccagtttatacctttcatgagaaag
tacaagattcaaaaggataaaccagaaacctttgaaggccagtggaagtgtttgaaagga
attctgtttaatcatttttttatccagttgcctctgatttgtggaacatactattttaca
gagtttttcaatattccttatgattgggaaagaatgccaagatggtatttcactttggca
aggtgtttgggctgtgcagtcatcgaggatacctggcactatttcctgcacagactcctt
caccacaagaggatttataaatacattcataaagtccatcacgagttccaggctccattt
ggaatcgaagcagaatatgcacatcccttggaaaccctaattcttgggactggatttttc
attggaattgtgcttttgtgtgatcatgtaattcttctgtgggcatgggtgaccatgcgt
ttgctagaaaccatcgatgtgcacagtggttatgatatccctctcaacccgttgaactac
atccctttttataccggggctcggcatcacgatttccaccacatgaacttcattgggaat
tacgcctccaccttcacgtggtgggacagaatctttgggacggatgtccagtaccatgcc
tacactgaaaagatgaagaagcttgggaaaaagtctgagtga

DBGET integrated database retrieval system