KEGG   Rattus norvegicus (rat): 140924
Entry
140924            CDS       T01003                                 

Gene name
Il2rg
Definition
(RefSeq) cytokine receptor common subunit gamma precursor
  KO
K05070  interleukin 2 receptor gamma
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04144  Endocytosis
rno04151  PI3K-Akt signaling pathway
rno04630  JAK-STAT signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno05162  Measles
rno05166  Human T-cell leukemia virus 1 infection
rno05200  Pathways in cancer
rno05321  Inflammatory bowel disease
rno05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    140924 (Il2rg)
   04151 PI3K-Akt signaling pathway
    140924 (Il2rg)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    140924 (Il2rg)
   04061 Viral protein interaction with cytokine and cytokine receptor
    140924 (Il2rg)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    140924 (Il2rg)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    140924 (Il2rg)
   04659 Th17 cell differentiation
    140924 (Il2rg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    140924 (Il2rg)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    140924 (Il2rg)
   05162 Measles
    140924 (Il2rg)
  09163 Immune disease
   05321 Inflammatory bowel disease
    140924 (Il2rg)
   05340 Primary immunodeficiency
    140924 (Il2rg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    140924 (Il2rg)
   04090 CD molecules [BR:rno04090]
    140924 (Il2rg)
Cytokine receptors [BR:rno04050]
 Interleukin receptor families
  IL2 receptor family
   140924 (Il2rg)
CD molecules [BR:rno04090]
 Proteins
  140924 (Il2rg)
SSDB
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind Interfer-bind IL4Ra_N
Other DBs
NCBI-GeneID: 140924
NCBI-ProteinID: NP_543165
RGD: 621466
Ensembl: ENSRNOG00000003954
Vega: OTTRNOG00000000601
UniProt: Q68FU6
Position
X
AA seq 368 aa
MLKPLLPSRSFLLLQLLLLRVGWSSKVLMSSGNEDTKSDLLLTSMDLKHLSVPTLPLPEV
QCFVFNVEYMNCTWNSSSEPQPTNLTMHYRYKGSDNNTFQECSHYLFSKEITSGCQIQKE
DIQLYQTFVVQLQDPQKPQRRAEQKLNLQNLVIPWAPENLTLYNLSESQVELRWKSRYIE
RCLQYLVQYRSNRDRSWTEQIVDHEPRFSLPSVDEQKLYTFRVRSRFNPICGSTQQWSKW
SQPIHWGSHTAEENPSLFALEAVLIPVGTMGLIITLIFVYCWLERMPRIPAIKNLEDLVT
EYHGNFSAWSGVSKGLTESLQPDYSERFCHVSEIPPKGGALGEGPGGSPCSLHSPYWPPP
CYSLKPEA
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgttgaaaccattattgccatctagatccttcttactccttcagctgcttctgctgagg
gtagggtggagctccaaggtcctcatgtccagtgggaatgaagacaccaaatctgatctc
ttgctgacttctatggaccttaaacatctcagtgttcctactctgcccctcccagaggtt
caatgctttgtgttcaatgtcgagtatatgaattgcacttggaatagcagttctgagcct
cagccgaccaacctcactatgcactataggtacaagggatctgataataatacattccag
gagtgcagccactatctgttctcaaaagagattacttctggctgtcagatacaaaaagaa
gatatccagctctaccagacatttgttgtccagcttcaggacccccagaaaccccagagg
cgagccgaacagaagctaaacctacagaatcttgtgatcccatgggctccagagaatcta
acactttataacctgagtgaatctcaggtagaactgaggtggaaaagcagatacatagaa
cgctgtttacaatacttggtgcagtaccggagcaaccgagatcgaagctggacggaacaa
atagtggatcatgagcctagattctccctgcctagtgtggatgaacagaagctgtacaca
tttcgggttcggagccgctttaacccgatctgtggaagtactcaacagtggagtaaatgg
agccaaccaatccactgggggagccatactgcagaggagaatccttccttgtttgcactg
gaagctgtgcttatccctgttggcaccatggggttgattattaccctgatctttgtgtac
tgttggttggaacgaatgcctcgaattcccgccatcaagaatctagaggatctggttact
gaataccatgggaacttttcggcctggagtggtgtgtctaaagggctgactgagagtctg
cagccagactacagtgaacggttctgccacgtcagtgagattcccccgaaaggaggagcc
ctaggagaggggcctggaggctctccttgcagccttcatagcccttactggcctccccca
tgttattctctgaagcctgaagcctga

KEGG   Rattus norvegicus (rat): 25704
Entry
25704             CDS       T01003                                 

Gene name
Il2ra
Definition
(RefSeq) interleukin-2 receptor subunit alpha precursor
  KO
K05068  interleukin 2 receptor alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04144  Endocytosis
rno04151  PI3K-Akt signaling pathway
rno04630  JAK-STAT signaling pathway
rno04640  Hematopoietic cell lineage
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno05162  Measles
rno05166  Human T-cell leukemia virus 1 infection
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    25704 (Il2ra)
   04151 PI3K-Akt signaling pathway
    25704 (Il2ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    25704 (Il2ra)
   04061 Viral protein interaction with cytokine and cytokine receptor
    25704 (Il2ra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    25704 (Il2ra)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    25704 (Il2ra)
   04658 Th1 and Th2 cell differentiation
    25704 (Il2ra)
   04659 Th17 cell differentiation
    25704 (Il2ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25704 (Il2ra)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    25704 (Il2ra)
   05162 Measles
    25704 (Il2ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    25704 (Il2ra)
   04090 CD molecules [BR:rno04090]
    25704 (Il2ra)
Cytokine receptors [BR:rno04050]
 Interleukin receptor families
  IL2 receptor family
   25704 (Il2ra)
CD molecules [BR:rno04090]
 Proteins
  25704 (Il2ra)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 25704
NCBI-ProteinID: NP_037295
RGD: 2895
Ensembl: ENSRNOG00000047647
UniProt: P26897
Position
17
AA seq 267 aa
MEPHLLMLGFLSFTIVPGCWAELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLNE
LVYMACLGNSWSNNCQCTSNSHDNSREQVTPQPEGQKEQQTTDTQKSTQSVYQENLAGHC
REPPPWRHEDTKRIYHFVEGQIVLYTCIQGYKALQRGPAISICKTVCGEIRWTHPQLTCV
DEKEHHQFLASEESQGSRNSFPESEASCPTPNTDFSQLTEATTTMETFVFTKEYQVAVAS
CIFLLLSILLLSGFTWQHRWRKSRRTI
NT seq 804 nt   +upstreamnt  +downstreamnt
atggagccacacttgctgatgttggggtttctctcattcaccatagtacccggctgttgg
gcagagctgtgtctgtatgacccaccggaggtccccaatgccacgttcaaagccctctcc
tacaagaacggcaccatcctaaactgtgaatgcaagagaggtttccgaagactgaatgag
ctggtctatatggcttgtctaggaaactcctggagcaacaactgtcagtgcacaagcaac
tcccatgacaactcaagagagcaagttacacctcaacctgaaggacagaaagagcaacag
accacggacacgcagaaatcaacacagtctgtgtaccaggagaaccttgcaggtcactgc
agggagccccctccttggagacatgaagacaccaagagaatctaccacttcgtggaagga
cagatagttctctacacgtgtattcaaggatacaaggctctacagagaggtcctgctatc
agcatctgcaagacagtgtgtggggagataaggtggacgcatccccagctcacgtgtgta
gatgaaaaagaacaccatcaatttctggctagtgaagaatctcaaggaagcagaaattct
ttcccagagagtgaggcttcctgtcccacccccaacacagacttctcacaactcacagaa
gcaactacaactatggagacattcgtgttcacaaaggagtatcaggtagcagtggccagc
tgcatcttcctgctcctcagcatcctcctcctgagtgggttcacctggcaacatagatgg
aggaagagcagaagaaccatctag

KEGG   Rattus norvegicus (rat): 25746
Entry
25746             CDS       T01003                                 

Gene name
Il2rb
Definition
(RefSeq) interleukin-2 receptor subunit beta precursor
  KO
K05069  interleukin 2 receptor beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04144  Endocytosis
rno04151  PI3K-Akt signaling pathway
rno04630  JAK-STAT signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno05162  Measles
rno05166  Human T-cell leukemia virus 1 infection
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    25746 (Il2rb)
   04151 PI3K-Akt signaling pathway
    25746 (Il2rb)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    25746 (Il2rb)
   04061 Viral protein interaction with cytokine and cytokine receptor
    25746 (Il2rb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    25746 (Il2rb)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    25746 (Il2rb)
   04659 Th17 cell differentiation
    25746 (Il2rb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25746 (Il2rb)
   05202 Transcriptional misregulation in cancer
    25746 (Il2rb)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    25746 (Il2rb)
   05162 Measles
    25746 (Il2rb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    25746 (Il2rb)
   04090 CD molecules [BR:rno04090]
    25746 (Il2rb)
Cytokine receptors [BR:rno04050]
 Interleukin receptor families
  IL2 receptor family
   25746 (Il2rb)
CD molecules [BR:rno04090]
 Proteins
  25746 (Il2rb)
SSDB
Motif
Pfam: IL2RB_N1 fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 25746
NCBI-ProteinID: NP_037327
RGD: 2896
Ensembl: ENSRNOG00000048636
UniProt: P26896
Position
7
AA seq 538 aa
MATVDLSWRLPLYILLLLLATTWVSAAVNDCSHLKCFYNSRANVSCMWSPEEALNVTSCH
IHAKSDMRHWNKTCELTPVRQASWACNLILGPLPDSQSLTSVDLLSLSVVCWEEKGWRRV
KTCNFHPFDNLRLIAPHSLQVLHIETRRCNISWEVSQVSHYVNPYLEFEARRRLLDRSWE
DASVFSLKQRQQWIFLETLTPDTSYELQVRVIAQRGKTRTWSPWSQPVAFRTRPADPKEI
FPLPWLRCLLLVLGCFFGFLSCVCVLVKCRYLGPWLKTLLKCHIPDPSEFFSQLSSQHGG
DLQKWLSSPVPQSFFSPTGSAPEISPLEVLDRDSKTMQMLLFQKEKASSPSPSGHSQASC
FTNQGYFFFHLSNALEIESCQVYFTYDPCMEEDVEEDGPRLPEESPLPPLLPFTGEQDDY
CAFPPRDDLLLFSPSLSTPNTAYGNSITPEERPPLSLQEGLPSLTSPDLMGLQHPLELVL
GDDGEGMSTNSSGQQASVPEGSSHGHDQDRGQGPVLTLNTDAYLSLQELQAQDSAHLI
NT seq 1617 nt   +upstreamnt  +downstreamnt
atggccaccgtagacctttcgtggcgtctgcccctctacatcctcctcttgctcctggct
acaacttgggtgtctgcagcagtgaacgactgttcccatcttaagtgcttctacaactca
agagccaatgtctcctgcatgtggagccctgaagaggccctgaacgtcacatcctgtcac
atccatgccaagtcggacatgcgacactggaataaaacctgtgagctaacccctgtgagg
caggcatcctgggcctgcaacctgattctcgggcccctcccagattcccagtcactgacc
tccgtagacctcctcagcctaagtgtggtgtgctgggaagagaaggggtggcgtagggtg
aagacctgcaacttccatccctttgacaaccttcgcctgattgcccctcattccctacaa
gtcctgcacattgaaacccggagatgtaacataagctgggaggtgtcccaggtctctcac
tacgttaatccatacttggaatttgaggcccgtagacgtcttctggaccgtagctgggag
gatgcatccgtattcagcctcaagcagaggcagcagtggatcttcttggagacgctgacc
cctgacacctcatatgagctccaggtgagggtcatagctcaacgaggcaaaaccaggacc
tggagcccctggagccagcccgtggcctttcggacaaggccagcagatcctaaggagatc
ttccccctgccatggctcagatgccttctactggtcctcggctgcttctttggcttcttg
tcctgcgtctgcgttttggtcaagtgccgctaccttgggccatggctgaagacacttctc
aagtgccacatcccagatccgtctgagttcttctcccaactgagctcccagcatggggga
gaccttcagaaatggctctcctcgcctgtcccccaatccttcttcagccccactggctct
gcacctgagatctccccactggaagtgcttgacagagattccaagaccatgcagatgctc
ctgtttcagaaggagaaggcctcttcaccctcgcccagtggccactcacaggccagctgc
ttcaccaaccaaggttacttcttcttccatttgtccaatgccttggagatcgagtcctgc
caggtgtacttcacctatgacccctgcatggaggaggatgtggaggaagatgggccaagg
ctgcccgaggaatctcccctcccacctctgctgcctttcactggagaacaggatgactac
tgtgccttcccgcccagggatgacctgctgctcttctccccaagcctgagcacccccaac
actgcctatgggaacagcataaccccggaagaaaggcctcccctctccctgcaggagggg
ctgccctccctaacatcccctgacctgatgggcttacagcaccctctggagctggtgctg
ggagatgacggagaagggatgtctaccaatagctctgggcaacaggccagtgtcccggaa
ggcagctctcatgggcacgaccaggacagaggccagggccctgtcctgactctaaacact
gatgcctatctgtctcttcaagaactacaggcccaagattcagcccacctaatatag

DBGET integrated database retrieval system