KEGG   Rattus norvegicus (rat): 140925Help
Entry
140925            CDS       T01003                                 

Gene name
As3mt, Cyt19
Definition
(RefSeq) arsenite methyltransferase
  KO
K07755  arsenite methyltransferase [EC:2.1.1.137]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    140925 (As3mt)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.137  arsenite methyltransferase
     140925 (As3mt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_11 Ubie_methyltran Methyltransf_23 Methyltransf_12 PCMT PrmA Methyltransf_8 TehB GidB MTS FtsJ Methyltransf_32
Motif
Other DBs
NCBI-GeneID: 140925
NCBI-ProteinID: NP_543166
RGD: 621325
Ensembl: ENSRNOG00000020081
UniProt: Q8VHT6
Position
1q54
AA seq 369 aa AA seqDB search
MAAPRDAEIHKDVQNYYGNVLKTSADLQTNACVTPAKGVPEYIRKSLQNVHEEVISRYYG
CGLVVPEHLENCRILDLGSGSGRDCYVLSQLVGQKGHITGIDMTKVQVEVAKAYLEYHTE
KFGFQTPNVTFLHGQIEMLAEAGIQKESYDIVISNCVINLVPDKQKVLREVYQVLKYGGE
LYFSDVYASLEVSEDIKSHKVLWGECLGGALYWKDLAVIAKKIGFCPPRLVTANIITVGN
KELERVLGDCRFVSATFRLFKLPKTEPAGRCQVVYNGGIMGHEKELIFDANFTFKEGEAV
EVDEETAAILRNSRFAHDFLFTPVEASLLAPQTKVIIRDPFKLAEESDKMKPRCAPEGTG
GCCGKRKSC
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggctgctccccgagacgcagagatccacaaggacgttcagaactactatgggaatgta
ctgaagacatctgcagacctccagactaatgcttgtgtcaccccagccaagggggtccct
gagtacatccggaaaagtctgcagaatgtacatgaagaagttatttccaggtattatggc
tgcggtctggtggtgcctgagcatctggaaaactgccggattttggatctgggcagtggg
agtggcagagattgctatgtgcttagccagctggtcggccagaagggacacatcaccggg
atagacatgactaaggtccaggtggaagtggctaaggcctatcttgagtaccacacggaa
aagttcggtttccagacacccaatgtgacttttcttcacggccaaattgagatgttggca
gaggccgggatccagaaggagagctatgatatcgttatatccaattgtgtgatcaacctt
gttcccgacaaacaaaaagtccttcgggaggtctaccaagtcctgaagtacggcggggag
ctctatttcagtgacgtctatgctagccttgaagtgtcagaagacatcaagtcacacaag
gttttatggggggaatgcctgggtggcgctctgtactggaaggacctcgccgtcattgcc
aaaaagattgggttctgccctccacgtttggtcactgccaatattattacggttggaaac
aaggaactagaaagggttcttggtgactgtcgcttcgtgtctgccacatttcgcctcttc
aaactccctaagacagagccagccggaagatgccaagttgtttacaatggaggaatcatg
gggcacgaaaaggaactaattttcgatgcaaattttacattcaaggaaggtgaagctgtt
gaagtggatgaggagacggcagccatcttgaggaactctcggtttgctcacgattttctc
ttcacacctgttgaggcctccctgttggctccccaaacaaaggttataatcagagatcca
ttcaagcttgcagaggaatctgacaagatgaagccgagatgtgcaccagaaggcactgga
ggctgctgtggcaaaaggaaaagctgctag

DBGET integrated database retrieval system