KEGG   Rattus norvegicus (rat): 140926
Entry
140926            CDS       T01003                                 

Gene name
Daxx
Definition
(RefSeq) death domain-associated protein 6
  KO
K02308  death-associated protein 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04210  Apoptosis
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05022  Pathways of neurodegeneration - multiple diseases
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    140926 (Daxx)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    140926 (Daxx)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    140926 (Daxx)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    140926 (Daxx)
   05014 Amyotrophic lateral sclerosis
    140926 (Daxx)
   05022 Pathways of neurodegeneration - multiple diseases
    140926 (Daxx)
SSDB
Motif
Pfam: Daxx CDC45 Nop14 Merozoite_SPAM SDA1
Other DBs
NCBI-GeneID: 140926
NCBI-ProteinID: NP_543167
RGD: 621227
Ensembl: ENSRNOG00000000477
Vega: OTTRNOG00000001948
UniProt: Q6MGC8
Position
20
AA seq 730 aa
MATDDSIIVLDDDDEDEAAAQPGPSNPASNPVSPGPEASGPSESHGDGGSSNSGSRKCYK
LENEKLFEEFLELCKMQTSDHPEVVPFLHKLQQRAQSAFLASAEFRNILSRVLSRSRNRP
AKLYVYINELCTVLKAHSIKKKLNLAPAASAESSGDNPPTDPPSDLTNTETTASEASRTR
GSRRQIQRLEQLLALYVAEIQRLQEKELDLSELDDPDSSYLQEARLKRKLIRLFGRLCEL
KDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAATRHSL
GLPRQQLQLLAQDAFRDVGVRLQERRHLDLIYNFGCHLTDDYRPGVDPALTDPTLARRLR
ENRTLAMSRLDEVISKYAMMQDKSEEGERQKRRARLLATSQSSDLPKASSDSGEGPSGVA
SQEDPTTPKAETEDEEDDEESDDEEEEEEEEEEEATEDEDEDLEQLQEDQDDEEEEEGDN
EDDKSPTSPSPIFRRRNSAPTEGLRSPEEQQERGLTGTPASPLEASPGLPSTDAESSGEQ
LQERLLAGESPVSQLSELDMEALPEETIPSPEERGISSSRRKSDSSLPTILENGAAMVTS
TSFNGRVSSHPCRDASPPSKRFRKEKKQLGPGPLENSYVKKQTMAQQDSGWKISVLSTPS
SPLASVGPVADSSTRVDSPSHELVTSSLCNPSPSLILQTPQSQSPRPCIYKTSVATQCDP
EEIIVLSDSD
NT seq 2193 nt   +upstreamnt  +downstreamnt
atggccaccgatgacagcatcattgtgcttgacgatgatgatgaagatgaagcagctgct
cagccaggaccctccaacccagcctctaatcctgtctcaccaggaccagaagcctctggt
ccctctgagtcccatggggatggagggagcagtaactcaggtagcaggaagtgctacaag
ttggagaatgagaagctgtttgaagagttccttgaactgtgtaagatgcagacatcggac
caccctgaggtggttccgttcctccacaaactgcagcagcgtgctcagtccgcttttctg
gcctctgcagagttccgcaacatcctctccagggttctgtctcggtctcggaaccggcca
gcgaagctctacgtctacattaacgagctctgcactgtccttaaagctcattccatcaag
aagaagttgaacttagctcccgcagcctcagcggaatcatcgggtgataaccctcccaca
gatcccccgtctgaccttacaaacaccgaaaccactgcctctgaggcctcaaggactcga
ggctcccggaggcagatccagcgcttggagcagctgctggcactgtatgtcgcagagata
cagcggctgcaggaaaaggagttggatctgtcagaactggatgatcccgactcctcctat
ttgcaggaggcccgcttgaagcggaaactgatccgcctctttgggcggctgtgcgagttg
aaggactgctcttctctgactgggagggtcatagagcagcgaattccttaccgaggcact
cgatacccagaggtcaacaggcgcatcgagcggctcatcaacaagccggggcctgacacg
tttccggactatggagatgtgctgagagcggtggagaaggcggcgacccggcacagtctg
ggccttcccagacagcagcttcagctcctggctcaggatgccttccgggatgtgggtgtc
aggttacaggagcgccgccacctggatctcatctataactttggctgccacctcacagat
gactataggccaggcgttgaccccgcactcaccgatcccacattggctcgccgccttcgg
gagaatcgaaccttggccatgagccggctggatgaggtcatctccaagtatgccatgatg
caagacaagagtgaggagggggagagacagaagagacgggcccggctcttagccacttcc
caatcttcagacctccccaaagcctcctcggattccggtgagggtcctagtggagtggca
tcccaggaggaccctactacccccaaggctgagaccgaggatgaggaagacgatgaggaa
agtgatgatgaagaggaggaagaggaagaggaggaggaggaggccaccgaagatgaagat
gaggatttagaacagttgcaggaggatcaggatgatgaagaggaggaggaaggagataat
gaagacgataaaagtcccacatccccttcgcccattttccgcagaaggaactcagcaccc
acagaagggctcaggtccccggaggagcagcaggagagaggactgacggggacgccagca
tccccgctggaagcatccccgggccttcccagcaccgatgctgaaagcagcggcgagcag
ctccaggagcggctcctggcaggagagagtcccgtgtcccagctttctgagctagacatg
gaagctctgcctgaggagaccatcccttcccctgaggaaaggggcatttcctcttccagg
agaaagtcagacagttccctccccaccatcttggaaaatggggcagctatggttacctct
acgtccttcaatgggcgtgtctcttctcacccttgtcgagatgccagtcccccaagcaag
agatttcggaaggaaaagaagcaactgggacctgggccgttagaaaacagctatgtaaaa
aagcagacgatggcacagcaggacagtgggtggaagataagtgtcctgtctactccgtcc
tcccccttggcctctgtgggtcctgttgctgattcctccacgagggtggactctcccagc
catgagctggtaaccagctccctgtgcaacccttctccatccctgatactccagactccc
cagtctcagtctccccggccttgtatttataagacgagtgtggccacccagtgcgatccc
gaggagatcatcgtgctctcagactctgattag

DBGET integrated database retrieval system